KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100389922
Entry
100389922         CDS       T03264                                 

Gene name
LRP6
Definition
(RefSeq) LDL receptor related protein 6
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05200  Pathways in cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100389922 (LRP6)
   04150 mTOR signaling pathway
    100389922 (LRP6)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100389922 (LRP6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100389922 (LRP6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100389922 (LRP6)
   05226 Gastric cancer
    100389922 (LRP6)
   05224 Breast cancer
    100389922 (LRP6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100389922 (LRP6)
   05022 Pathways of neurodegeneration - multiple diseases
    100389922 (LRP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100389922 (LRP6)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    100389922 (LRP6)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL cEGF EGF
Other DBs
NCBI-GeneID: 100389922
NCBI-ProteinID: XP_002752182
Ensembl: ENSCJAG00000021643
UniProt: U3DLY0
LinkDB
Position
9
AA seq 1613 aa
MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATHGKENATIVVGGLEDAAAVDFVF
GHGLIYWSDVSEEAIKQTEFNKTESVQRVVVSGILSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPTSGFMYWTDWGEVPKIERAGMDGSSRFIIVNSD
IYWPNGLTVDYEERKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWT
DWNTHSILACNKYTGEGLHEIHSNIFSPMDIHVFSQQRQPNATNLCAIDNGGCSHLCLMS
PVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAVDYDPVEGYIYWTDDEVRAIRRSFLDGSGSQFVVTAQIAHPDGVAVDWIARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYDEGKVYWGDAKTDKIEVVNTDGSGRRVLVEDKIPHIFGFTL
LGDYVYWTDWQRRSIERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCS
HLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQSGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNADNKTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLS
IDIYSRYIYWTCEAANVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERS
PKIERAALDGTEREVLFFSGLSKPVALALDSRLGKLFWADSDLRRIESSDLSGANRIVLE
DSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQ
EYRQHPCAQDNGGCSHICLVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPQQFTCFTGE
IDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEK
TCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGV
IVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPGSLSGSLPGMS
RGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTM
EFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDL
NYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
NT seq 4842 nt   +upstreamnt  +downstreamnt
atgggggccgtcctgaggagcctcctggcctgcagcttctgtgtgctcctgagagcggcc
cctttgttgctttatgcaaacagacgggacttgcgattggttgatgctacacatggcaaa
gagaatgctacgattgtagttggaggcttggaggatgcagctgcggtggactttgtgttt
ggtcatggcttgatatactggagtgatgtcagcgaagaagccattaaacaaacagaattt
aacaaaactgagagtgtacagcgtgttgttgtttctggaatattgtcccctgatgggctg
gcatgtgattggcttggagaaaaattgtactggacagattctgaaactaatcggattgaa
gtttctaatttagatggatctttacgaaaagttttattttggcaagagttggatcaaccc
agagctattgccttagatcctacaagtgggttcatgtactggacagactggggagaagtg
ccaaagatagaacgtgctggaatggatggttcaagtcgcttcattatagtaaacagtgat
atttactggccaaatggactgactgtggattatgaagaacgaaagctttactgggcagat
gcaaaacttaatttcatccacaaatcaaatctggatggaacaaatcggcaggcagtggtt
aaaggttcccttccacatccttttgccttgacgttatttgaggacacattgtactggact
gactggaacacacactccattttggcttgcaacaagtatactggtgagggtctgcatgaa
atccattctaacatcttctcgcccatggatatacatgtcttcagccaacagaggcagcca
aatgctacaaatctatgtgcaattgacaatggtggttgttcccatttgtgtttgatgtct
ccagtcaaacctttttatcagtgtgcttgccccactggggtcaaactcctggagaatgga
aaaacttgcaaagatggtgccactgaattactgcttttagctcgaaggacagacttgaga
cgcatttcgttggatacaccagattttacagacattgttctgcagttggaagacatccgt
catgccatcgccgtagattacgatcctgtggaaggctacatctactggactgatgatgaa
gtgagggccatacgccgttcattcttagatgggtctggcagtcagtttgtggtcactgct
caaattgcccatcctgatggtgttgctgtggactggattgcacgaaatctttattggaca
gacactggcactgatcgaatagaagtgacaaggctcaatgggaccatgaggaagatcttg
atttcagaggacttagaagaaccccgggctattgtgttagatcccatggttgggtacatg
tattggactgactggggagaaattccgaaaattgagcgagcagctctggatggttctgac
cgtgtagtattggttaacacttctcttggttggccaaatggtttagccttggattatgat
gaaggcaaagtatactggggagatgccaaaacagacaaaattgaggttgtaaatactgat
ggctctgggagacgcgtattagtggaagacaaaattcctcacatatttggatttactttg
ttgggtgactacgtttactggactgactggcagaggcgtagcattgaaagagtacataaa
cgaagtgcagagagggaagttatcatagatcagctgcctgacctcatgggcctaaaggcc
acaaatgttcatcgagtgattggttccaacccctgtgcggaggaaaatgggggatgtagc
catctctgcctctatagacctcagggccttcgctgtgcttgccctattggcttcgaactc
atcagtgacatgaagacctgcattgtcccagaggctttccttttgttttcacggagagca
gatatcagacgaatttctttggaaacaaacaataacaatgtggctattccactcactggt
gtcaaggaagcttctgctttggattttgatgtgacagacaaccgaatttactggactgat
atatcactcaagaccatcagcagagcctttatgaatggcagtgctctggaacacgtggta
gaattcggcttggattatccagaaggcatggcagtagactggcttgggaagaacttgtac
tgggcagacacaggaacaaatcgaattgaggtgtcaaagttggatgggcagcaccgacaa
gttttggtgtggaaagacctagatagtcccagagctctagcattggaccctgccgaagga
tttatgtattggactgaatggggtggaaaacctaagatagacagagctgcaatggatgga
agtgaacgtactaccttagttccaaatgtggggcgggcaaacggcctgactattgattat
gctaaaaggaggctttattggacagacctggacaccaacttaatagaatcttcaaatatg
cttggactcaaccgtgaagttatagcagatgacttgcctcatccttttggcttaactcag
taccaagattatatctactggacagactggagccgacgcagcattgagcgtgccaacaaa
accagtggccaaaaccgcaccatcattcagggccatttggattatgtgatggacatcctc
gtctttcactcctctcgacagtcagggtggaatgaatgtgcttccagcaatgggcactgc
tcccacctctgcttggctgtgccagttgggggttttgtttgtggatgccctgcccactac
tctcttaatgctgacaacaagacttgtagtgctcctaccactttcctgctcttcagtcaa
aagagtgccatcaaccgcatggtgattgatgaacaacagagccctgacatcatccttccc
atccacagccttcggaatgtccgggccattgactatgacccactggacaagcaactctat
tggattgactcccgacaaaacatgatccgaaaggcacaagaagatggcagccagggcttt
actgtggttgtgagctctgttccgagtcagaacctggaaatacaaccttatgacctcagc
attgatatttacagccgctatatctactggacttgtgaggctgccaatgtcattaatgtg
acaagattagatgggagatcaattggagtggtgctaaaaggcgagcaggacagacctcga
gccattgtggtaaacccagagaaagggtatatgtattttaccaatcttcaggaaaggtct
cctaaaattgaacgggctgctttggatgggacagaacgggaggtcctctttttcagtggc
ttaagtaaaccagttgctttagctcttgatagcaggctgggcaagctcttttgggccgat
tcagatctccggcgaattgaaagcagtgatctctcaggtgctaaccggatagtactagaa
gactccaatatcttgcagcctgtgggtcttactgtgtttgaaaactggctctattggatt
gataaacagcaacaaatgattgaaaaaattgacatgacaggtcgagagggtagaaccaaa
gtccaggctcgaattgcccagcttagtgacattcatgcagtaaaggagctgaaccttcaa
gaatacagacagcacccttgtgctcaggataatggtggctgttcacatatctgtcttgta
aagggggatggtactacaaggtgttcttgccccgtgcacctggttctgcttcaagatgag
ctatcatgtggagaacccccaacatgttctcctcagcagtttacttgtttcacgggggaa
attgactgtatccctgtggcttggcgatgtgatgggtttactgaatgtgaagaccacagt
gacgaactcaattgtcccgtatgctcagagtcccagttccagtgtgccagcgggcagtgt
attgatggtgccctccgatgcaacggagatgcaaactgccaggacaaatccgacgagaag
acctgtgaagtgctttgtttaattgatcagttccgctgtgccaatggtcagtgcattgga
aagcacaagaagtgtgatcataatgtggattgtagtgacaaatcagatgaactggattgt
tatccaactgaagaaccagcaccacaggccaccaatacagtcggttctgttattggagta
attgtcaccatttttgtgtctggaaccatatactttatctgccagaggatgttgtgtcca
cgtatgaaaggagatggggaaaccatgactaatgactatgtagttcatggaccagcttct
gtgcctcttggttatgtgccacacccaggttctttgtcaggatctcttccaggaatgtct
cgaggtaaatcaatgataagctccctcagtatcatggggggtagcagcggacccccctac
gatcgagctcatgttacaggagcatcctcaagtagttcttcaagcaccaaaggcacttac
ttccctgcgattttgaaccctccaccatccccagccacagaacgatcacattacactatg
gaatttggatattcttcaaacagtccttctactcataggtcatacagctacaggccatat
agttaccggcactttgcaccccccaccacaccctgcagcacagatgtttgtgacagtgac
tatgctcctagccggagaatgacctcagtggcaacagccaagggctataccagtgacttg
aactatgattcagaacctgtgcccccacctcccacacctcgaagccaatacttgtcggca
gaggagaactatgaaagctgcccgccttctccatacacagagaggagctattctcatcac
ctctacccaccgccaccctctccctgtacagactcctcctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406268
Entry
100406268         CDS       T03264                                 

Gene name
LRP5
Definition
(RefSeq) LDL receptor related protein 5
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05200  Pathways in cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100406268 (LRP5)
   04150 mTOR signaling pathway
    100406268 (LRP5)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100406268 (LRP5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100406268 (LRP5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100406268 (LRP5)
   05226 Gastric cancer
    100406268 (LRP5)
   05224 Breast cancer
    100406268 (LRP5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100406268 (LRP5)
   05022 Pathways of neurodegeneration - multiple diseases
    100406268 (LRP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100406268 (LRP5)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    100406268 (LRP5)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL Insulin_TMD DUF5653
Other DBs
NCBI-GeneID: 100406268
NCBI-ProteinID: XP_009006861
Ensembl: ENSCJAG00000015736
UniProt: U3D8R2
LinkDB
Position
11
AA seq 1611 aa
MEAAPPRPPWPLLLLLVLGGCSAPAAASPLLLFANRRDVRLVDAGRVKLETTVVVSGLED
AAAVDFQFSKGVVYWTDVSEEAIKQTYLNHTGVAVQNVVISGLVSPDGLACDWVGKKLYW
TDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALNPAHGYMYWTDWGEMPRIERAGMDGT
TRNIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALT
LSGDTLYWTDWQTRSIHACNKRTGGKRKEILSALYSPMDIQVLSQERQPFFHTRCEEDNG
GCSHLCLLSPVEPFYKCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTD
IVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLINTDINDPDGIAVD
WVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIALHPVMGLMYWTDWGENPKI
ECANLDGQERRVLVNASLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDK
LPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDIIIDQLPDLMGLKAVNVAKIMGTNP
CADENGGCSHLCFFTPRSTRCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNN
NDVAIPLTGVKEASALDFDVANNHIYWTDVSLKTISRAFLNGSSVEHVVEFGLDYPEGMA
VDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTEGYIYWTEWGGKP
RIVRAFMDGTNCMTLVDKVGRANDLTIDYTDRRLYWTDLDTNMIESSNMLGQERVVIADD
LPHPFGLTQYSDYIYWTDWNLHSIERADKTSGQNRTLIQGHLDFVMDILVFHSSRQDGLN
DCVHDNGQCGQLCLAIPGGHRCGCASHYTLDPSGRNCSPPTTFLLFSQKSAISRMIPDDQ
HSPDLVLPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQAQNPDR
QPHDLSIDIYSRTLFWTCEATNTINVHRLSGEAIGVVLRGDRDKPRAIVVNAERGYLYFT
NMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNALGKLFWADADLKRIESCDLSGA
NRLTLEDANIVQPLGLTVLGKHLYWIDRQQQMIERVEKTTGDKRTRIQGRVTHLTGIHAV
EDVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQF
ACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQ
DRSDEADCDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEINKPPSDDTGAHS
SAIGPVIGIILSLFVMGGIYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQ
HGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSP
ATDPSLYNMDMFYSSNIPATTRPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYYL
DLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
NT seq 4836 nt   +upstreamnt  +downstreamnt
atggaggcagcgccgccccggccgccgtggccgttgctgctgctgctggtgctgggtggc
tgctcggcccccgccgcggcctcgccactcctgctgtttgcaaaccgccgggatgtacgg
ctggtggacgccggcagagtcaagctggagaccaccgtcgtggttagcggcctggaggat
gcggccgctgtggacttccagttctccaagggagtcgtgtactggacagacgtgagtgag
gaggccatcaagcagacctacctgaaccacacgggcgtcgccgtccagaacgtggtcatc
tctggcctggtctcgcccgacggcctggcctgcgactgggtgggcaagaagctgtactgg
acggactcagagaccaaccgcatcgaggtggccaacctcaatggcacgtctcggaaggtc
ctcttctggcaggaccttgaccagccgagggccatcgccttgaaccccgctcacgggtac
atgtactggacagattggggtgagatgccccgaatcgagcgggcggggatggacggcacc
acccggaatatcattgtggactcggacatttactggcccaatgggctgaccatcgacctg
gaggagcagaagctctactgggctgacgccaagctcagcttcatccaccgcgccaacctg
gatggctcgttccggcagaaggtggtggagggcagcctgacgcaccccttcgccctgacg
ctctcgggggacactctgtactggacagactggcagacccgctccatccatgcctgcaac
aagcgcactgggggtaagaggaaggagatcctgagcgccctctactcacccatggacatc
caggtgctgagccaggagcggcagcctttcttccacactcgctgcgaggaggacaatggt
ggctgctcccacctgtgcctgctgtccccggtggagcctttctacaagtgtgcctgcccc
acgggcgtgcagctgcaggacaatggcaggacgtgtaaggcaggagccgaggaggtgctg
ctgctggcccggcggacagacctgcggaggatctcactggacacgccggacttcaccgac
atcgtgctgcaggtggatgacatccggcacgccattgccatcgactatgacccgctggag
ggctacgtctactggacggatgacgaggtgcgggccatccgcagggcgtacctggatggg
tcgggggcgcagacgctgatcaacaccgacatcaacgaccccgacggcatcgcagtcgac
tgggtggcccgaaacctctactggaccgacacgggcactgaccgcatcgaggtgacacgc
ctcaacggcacctcccgcaagatcctggtgtcggaggacctggacgagccccgcgccatc
gcgctgcaccccgtgatgggcctcatgtactggacagactggggagagaaccctaaaatc
gagtgtgccaacctggacgggcaggagcggcgtgtgctggtcaatgcctcccttgggtgg
cccaacggcctggccctggacctgcaggaggggaagctctactggggagacgccaagacg
gacaagatcgaggtgatcaatgtcgatgggacgaagaggcggaccctgctggaggacaag
ctcccgcacatttttgggttcacgctgctgggagacttcatctactggactgactggcag
cgccgcagcattgagcgggtgcacaaggtcaaggccagccgggacattatcattgaccag
ctgcccgacctgatggggctcaaagccgtgaatgtggccaagatcatgggaaccaacccg
tgcgctgatgagaacggcgggtgcagtcacctgtgcttcttcacgccccgctccacccgg
tgtggctgccccatcggcctggagctgctgagcgacatgaagacctgcatcgtgcccgag
gccttcttggtcttcaccagcagagccgccatccacaggatctccctcgagaccaacaac
aacgacgtggccatcccgctcacgggcgtcaaggaggcctcagccctggactttgacgtg
gccaacaaccacatctactggacggacgtcagcctgaagaccatcagccgtgccttcctg
aacgggagctccgtggagcacgtggtagagtttggccttgactaccccgagggcatggcc
gttgactggatgggcaagaacctctattgggctgacaccgggaccaacaggatcgaagtg
gcgcggctggacgggcagttccggcaagtcctcgtgtggagggacctggacaacccgagg
tcactggccctggatcccaccgagggctacatctactggactgagtggggcggcaagccg
aggattgtgcgggccttcatggacgggaccaactgcatgacgttggtggacaaggtgggc
cgggccaacgacctcaccattgactacactgaccgtcgcctctactggaccgacctggac
accaacatgattgagtcgtccaacatgctgggtcaggagcgggtcgtgattgccgacgac
ctgccgcacccgttcggtctgacgcagtacagcgattatatctactggacggactggaat
ctgcacagcatcgagcgggccgacaagaccagcggccagaaccgcaccctcatccagggc
cacctggacttcgtgatggacatcctggtgttccactcctcccgccaggatggcctcaac
gactgcgtgcacgacaacgggcagtgcgggcagctgtgccttgccatccccggcggccac
cgctgcggctgcgcctcacactacaccctggaccccagcggccgcaactgcagcccaccc
accaccttcttgctgttcagccagaaatctgccatcagccggatgatcccggacgaccag
cacagcccggacctcgtcctgcccctgcacgggctgaggaacgtcaaggccatcgactat
gacccactggacaagttcatctactgggtggacgggcgccagaacatcaagcgagccaag
gacgacgggacccagccctttgttttgacctctctgagccaagcccaaaacccagacagg
cagccccacgacctcagcatcgacatctacagccggacgctgttctggacatgtgaggcc
accaacaccatcaacgtccacaggctgagcggggaagccattggggtggtgctgcgtgga
gaccgcgacaagcccagggccatcgtcgtcaacgcagagcgagggtacctgtacttcacc
aacatgcaggaccgggcagccaagatcgagcgtgcggccctggacggcactgagcgggag
gtcctcttcaccaccggtctcatccgccccgtggccctggtggtagacaatgcactgggc
aagctgttctgggcggatgcagacctgaagcgcattgagagctgcgatctctcaggggcc
aaccgcctgaccctggaggacgccaacatcgtgcagcctctgggcctgactgtgcttggc
aagcacctctactggatcgaccgccagcagcagatgattgagcgtgtggagaagaccacc
ggggacaagcggactcgcatccagggccgcgtcacccacctcacgggcatccacgcggtg
gaggacgtcagcctggaggagttctcagcccacccatgtgcccgtgacaatggtggctgc
tcccacatctgtattgccaagggtgatgggacaccacggtgctcatgcccagtccacctc
gttctcctgcagaacctgctgacctgtggagagccgcccacctgctcccctgaccagttt
gcgtgtgccaccggggagatcgactgtatccccggggcctggcgctgcgacggctttcct
gagtgtgacgaccagagtgacgaggagggctgccccgtgtgctccgctgcccagttcccc
tgcgcccggggccagtgtgtggacctgcgcctgcgctgcgatggcgaggctgactgtcag
gatcgctcagacgaggccgactgtgacgccatctgcctgcccaaccagttccggtgtgcc
agcggccagtgcgtcctcatcaagcagcagtgtgactccttccccgactgcattgacggc
tccgatgagctcatgtgtgaaatcaacaagccgccctcagatgacactggagcccacagc
agcgccatcgggcctgtcatcggcatcatcctctccctctttgtcatgggtggcatctac
tttgtgtgccagcgcgtggtgtgccagcgctatgcgggggccaatgggcccttcccgcac
gagtatgtcagcggcacaccgcacgtgcctctcaatttcatagccccgggtggttcccag
catggtccctttacaggcatcgcatgtggaaagtccatgatgagctctgtgagcctgatg
gggggccggggcggggtgcccctctacgaccggaaccacgtcacaggggcctcatccagc
agctcatccagcacgaaggccacgctgtacccgccgatcctgaacccaccaccctccccg
gccacggacccctcgctgtacaacatggacatgttctactcttcaaacattccggccacc
acgagaccgtacaggccttacatcattcgaggaatggcacccccgacgacaccctgcagc
accgacgtgtgtgacagcgactacagtgccagccgctggaaggccagcaagtactacctg
gatttgaactcagactcagacccctacccgcccccacccacgccccacagccagtacctg
tcggcagaggacagctgcccgccctcgcccgccacagagaggagctacttccacctcttc
ccgccccctccatccccctgcacggactcgtcctga

DBGET integrated database retrieval system