KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390099
Entry
100390099         CDS       T03264                                 

Gene name
RIMS2
Definition
(RefSeq) regulating synaptic membrane exocytosis 2
  KO
K15297  regulating synaptic membrane exocytosis protein 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100390099 (RIMS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100390099 (RIMS2)
Membrane trafficking [BR:cjc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    100390099 (RIMS2)
  Small GTPases and associated proteins
   Rab associated proteins
    100390099 (RIMS2)
SSDB
Motif
Pfam: C2 FYVE_2 PDZ_6 PDZ Nudix_N_2
Other DBs
NCBI-GeneID: 100390099
NCBI-ProteinID: XP_017821131
LinkDB
Position
16
AA seq 1697 aa
MDRQKKEEEKEQSVLKVKEEHKPQLTQWFPFSGITELVNNVLQPQQKQQNEKEPQTKLHQ
QFEMYKEQVKKMGEESQQQQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRV
SLRSNKEDKVVMWVCNLCRKQQEILTKSGAWFYNSGSNTPQQPDQKVLRGLRNEEAPQEK
KAKLHEQPQFQGPSGDLSVPAVEKSRSHGLTRQDSIKNGSGVKHHIASDIASDRKRSPSV
SRDQNRRYDQREEREEYSHYATSDSAMPRSPSDYADRRSQHEPQFYEDSDHLSYRDSNRR
SHRHSKEYIVDDEDVEIRDEYERQRREEEYQARYRSDPNLARYPVKPQPYEEQMRIHAEV
SRARHERRHSDVSLANADLDDSRISMLRMDRPSRQRSVSERRAAMENQRSYSMERTREAQ
GSSSYAQRTTNHSPPTPRRSPLPIDRPDLRRTDSLRKQHHLEPSSAVRKTKREKMETMLR
NDSLSSDQSESVRPPPPKPHKSKKGGKMRQVSLSSSEEELASTPEYTSCDDVEIESESVS
EKGDSQKGKRKTSEQAVLSDSNTRSERQKKMMYFGGHSLEEDLEWSEPQIKDSGVDTCSS
TTLNEEHSHSDKHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAMLGLKVVGGKMTE
SGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVEL
VVSRPIGDIPRIPDSTYAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLS
SQSLSRRTTPFVPRVQIKLWFDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRS
DKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILI
ELETALLDDEPHWYKLQTHDISSLPLPHPSPYMPRRQLHGESPTRRLQRSKRISDSEVSD
YDCDDGIGVVSDYRHDGRDLQSSTLSVPEQVMSSNHCSPSGSPHRVDVIGRTRSWSPSVP
PPQSRNVEQGLRGTRATTGHYNTISRMDRHRVMDDHYSPDRDSHFLTLPRSRYSQSIDHH
HRDGRDCEAADRQPYHRSRSTEQQPLLERTTTRSRSTERPDTNLMRSMPSLMTGRSAPPS
PALSRSHPRTGSVQTSPSSTPLAGRRGRQLPQLPPKGTLERNNGVKEIEPYEEELDSTRR
RYAGTMDIEERNRQMKINKYKQVAGSDPRLEQDYHSKYRSGWDPHRGADNVSTKSSDSDV
SDISAVSRTSSASRFSSTSYMSVQSERPRGNKKIRPKGIEEGGKEGDKHEEIVHEKEEVK
EERINENEKGKEISKTCNKEKNRESGDEKKTQDIPEQGKEKEQWNKEDLQRRFSQDDSSV
FTSKMQSRQMGISGKNMTKSTSISGDMCSLEKNDGSQSDTAVGALGTSSKKRRSSIGAKM
VAIVGLSRKSRSASQLSQTEAGGKKLRSTVQRSTETGLAVEMRNWMTRQASRESTDGSMN
SYSSEGNLIFPGVRLASDSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEV
EIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKVARKTLEPLYQQLLSFEESPQ
GKVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLFPPSSLVDPTLAPLTRR
ASQSSLESSTGPSYSRS
NT seq 5094 nt   +upstreamnt  +downstreamnt
atggacagacagaagaaagaagaggagaaggagcagtccgtgctcaaggtcaaagaagaa
cacaaaccacaactgacacagtggtttccctttagtggaatcactgaactggtaaataac
gttcttcagccccagcaaaaacaacaaaatgaaaaggagccccagacaaaactgcatcag
cagtttgaaatgtataaggagcaggtaaagaagatgggagaagaatcacagcaacagcaa
gaacagaagggtgatgccccaacctgtggtatctgccacaaaacaaaatttgctgatgga
tgtggccataactgttcatattgccaaacaaagttctgtgctcgttgtggaggccgagtg
tcattacgctcaaacaaggaggacaaagtggttatgtgggtatgtaatttgtgccgaaaa
caacaagaaatcctcactaaatcaggagcatggttttataatagtggatctaacacaccg
cagcaaccggatcaaaaggttcttcgagggctaagaaatgaggaggcacctcaggagaag
aaagcaaaactacatgaacagccccagttccaaggaccctcaggtgacttatctgtacct
gcagtggagaaaagtcgatctcatgggctcacaagacaggattctattaaaaatgggtca
ggcgtgaagcaccacattgccagtgacatagcttcagacaggaaaagaagtccatctgtg
tccagagatcagaatagaagatacgaccaaagggaagaaagagaggaatattcacactat
gctacttccgatagcgcaatgcctagatctccatcagattatgctgataggcgatctcaa
catgaacctcagttttatgaagactctgatcatttaagttatagggactccaacaggaga
agtcataggcattccaaagaatatattgtagatgatgaggatgtggaaatcagagacgaa
tatgaaagacaaaggagagaggaagagtatcaggcacgctaccgaagtgatccgaatttg
gcccgttacccagtaaagccacaaccctatgaagaacaaatgcggatccatgctgaagtg
tcccgagcacggcatgagagaaggcatagtgatgtttctttggcaaatgctgacctagac
gattccaggatttctatgctaaggatggaccgaccatcaaggcaaagatctgtatctgaa
cgtagagctgccatggaaaatcagcgatcttattcaatggaaagaactcgagaggctcag
ggatcaagttcttatgcacaaaggaccacaaaccatagtcctcctaccccacggaggagt
ccactacctatagacagaccagacttgaggcgtactgactcactaaggaaacagcaccac
ttagagcctagctctgctgtaagaaaaacaaaacgggaaaaaatggaaacaatgttaagg
aatgattctctcagttcagaccagtcagagtcagtgagacctccaccgccaaagcctcat
aaatcaaagaaaggaggtaaaatgcgccaggtttcgttgagcagttcagaggaggaattg
gcttccacacctgaatatacaagttgtgatgatgttgagattgaaagtgagagtgtaagt
gaaaaaggggacagtcaaaagggaaaaagaaaaactagtgagcaggcagttttgtcggac
tctaacaccaggtctgagagacaaaagaaaatgatgtactttggtggccactctttggaa
gaggatttggaatggtctgagcctcagattaaggactctggggtagatacgtgtagtagc
acaacccttaacgaggagcatagtcatagtgataagcaccctgtaacctggcagccatct
aaagatggagatcgtttaattggtcgcattttattaaataagcgtctaaaagatggaagt
gtacctcgagattcaggagcaatgcttggcttgaaggtcgtaggaggaaagatgactgaa
tcaggtcggctttgtgcattcattactaaagtaaaaaaaggaagtttagctgatactgta
ggacatcttagaccaggtgatgaagtgttagaatggaatggaaggctattgcaaggagcc
acctttgaggaagtatacaacattattctagaatccaaacctgaaccacaagtggagctt
gtagtttccaggcctattggtgatatacctagaatacctgatagcacatatgcacaactg
gagtccagttctagctcctttgagtctcaaaaaatggatcgtccttctatttctgttacc
tcgcctatgagtcctggaatgttgcgggatgttccacagttcttatcaggacaactttca
agccaaagccttagtagaagaacaacgccttttgttcctagggttcagataaaactatgg
tttgacaaggttggtcaccaattaatagttacaattttgggagcaaaggatctcccttcc
agggaagatgggaggccaaggaatccttatgttaaaatctactttcttccagacagaagt
gataaaaacaagagaagaactaaaacagtaaagaaaactttggaacccaaatggaaccaa
acatttatttattctccagtccaccgaagagaatttcgggaacggatgctagagattacc
ctttgggatcaagctcgagttcgagaggaagaaagtgaattcttaggcgagattttaatt
gaattagaaacagcattattagatgatgagccacattggtacaaacttcaaacgcatgat
atctcttcattgccacttccccacccttctccttatatgccacgaagacagctccatgga
gagagcccaacaaggaggttacaaaggtcaaagagaataagtgatagtgaagtctctgac
tatgattgtgatgatggaattggtgtagtatcagattatcgacatgatggtcgagatctt
caaagctcaacattatcagtgccagagcaagtaatgtcatcaaaccattgttcaccatca
gggtctcctcatcgagtagatgttataggaaggactagatcctggtcacccagtgtccct
ccaccacaaagtcggaatgtggaacaggggcttcgagggacacgcgctactactggacat
tataatacaattagccgaatggatagacatcgtgtcatggatgaccattattctccagat
agagacagtcattttcttactctacctcgctccagatacagtcagagcattgaccatcat
cacagggatggcagggattgtgaagcagcagatagacagccatatcacagatccagatca
acagaacaacagcctctccttgagcggaccaccacccgctccagatccactgaacgtcct
gatacaaacctcatgaggtcgatgccttcattaatgactggaagatctgcccctccttca
cctgccttatcgaggtctcatcctcgtactgggtctgtccagacaagcccatcaagtact
ccattggcaggacgaaggggccgacagcttccacagcttccaccaaagggaacattggag
agaaacaatggagtcaaggagatagaaccttatgaagaagaactggactctacaaggaga
agatatgcaggtactatggatatagaggagagaaatcgccaaatgaaaattaacaaatac
aaacaggtagccggatcagatcccagactggaacaagattaccattcgaagtatcgatca
ggatgggatcctcatagaggggcagataatgtttctactaaatcttcggacagtgatgta
agtgatatatctgcggtttcaaggactagtagtgcttctcgtttcagcagcacaagctac
atgtctgtccaatcagaacggccaagaggaaacaagaaaataagacccaagggaatagaa
gagggagggaaagaaggggataagcacgaagagatagttcatgagaaggaagaggtaaag
gaagaaagaattaatgagaatgagaaagggaaagagatttccaaaacgtgtaataaggag
aaaaacagagaatcaggagacgagaaaaaaacacaagatatacccgagcaagggaaagaa
aaagaacagtggaataaagaggatttgcaaaggagattctcacaagatgattccagtgtc
tttacatccaaaatgcaaagcagacaaatgggcatatcagggaagaacatgacaaaaagc
accagcatcagtggagacatgtgctcgctggagaagaatgatggcagccagtctgacact
gcagtgggcgccctgggcaccagcagcaaaaagcggcgctctagcattggggccaaaatg
gtagctattgttggtctctcacggaaaagtcgcagcgcttctcagctcagccaaacggaa
gcaggaggtaaaaaactaaggagcactgtccagagaagtacagaaacagggctggccgtg
gagatgaggaactggatgactcgacaggcaagccgagagtctacagatggcagcatgaac
agctacagctcagaaggaaatctgatcttccctggtgtccgcttggcctctgatagccag
ttcagcgattttctggatggccttggccctgctcagctagtgggacgccagactctggct
actcccgcaatgggtgacattcaggtaggaatgatggacaaaaagggacagttggaggtg
gaaatcatccgggcccgtggccttgttgtaaaaccaggttccaagacactgccagcaccg
tatgtaaaggtgtatctattagacaatggagtctgcatagccaaaaaaaaaacaaaagtg
gcaagaaagacgctggaacccctttaccagcagctgttatctttcgaagagagtccacaa
ggaaaagttttacagatcattgtctggggagattatggccgcatggatcacaaatctttt
atgggagtggcccagatacttttagatgaactagagctatccaatatggtgatcggatgg
ttcaaacttttccctccgtcctccctagtagatccaaccttggcccctctgacaagaaga
gcttcccaatcatctctggaaagttcaaccggaccttcttactctcgttcatag

DBGET integrated database retrieval system