KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390192
Entry
100390192         CDS       T03264                                 

Gene name
FGFR1
Definition
(RefSeq) fibroblast growth factor receptor 1
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04520  Adherens junction
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04714  Thermogenesis
cjc04810  Regulation of actin cytoskeleton
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05215  Prostate cancer
cjc05218  Melanoma
cjc05224  Breast cancer
cjc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100390192 (FGFR1)
   04014 Ras signaling pathway
    100390192 (FGFR1)
   04015 Rap1 signaling pathway
    100390192 (FGFR1)
   04020 Calcium signaling pathway
    100390192 (FGFR1)
   04151 PI3K-Akt signaling pathway
    100390192 (FGFR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100390192 (FGFR1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100390192 (FGFR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100390192 (FGFR1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100390192 (FGFR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100390192 (FGFR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100390192 (FGFR1)
   05205 Proteoglycans in cancer
    100390192 (FGFR1)
   05230 Central carbon metabolism in cancer
    100390192 (FGFR1)
  09162 Cancer: specific types
   05218 Melanoma
    100390192 (FGFR1)
   05215 Prostate cancer
    100390192 (FGFR1)
   05224 Breast cancer
    100390192 (FGFR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100390192 (FGFR1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cjc04090]
    100390192 (FGFR1)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100390192 (FGFR1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100390192 (FGFR1)
Protein kinases [BR:cjc01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   100390192 (FGFR1)
CD molecules [BR:cjc04090]
 Proteins
  100390192 (FGFR1)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100390192 (FGFR1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 FGFR3_TM V-set C2-set_2 Ig_6 Pkinase_fungal DUF1615 DUF4611
Other DBs
NCBI-GeneID: 100390192
NCBI-ProteinID: XP_008977591
Ensembl: ENSCJAG00000002394
LinkDB
Position
13
AA seq 822 aa
MWSWKCLLFWAVLVTATLCTARPAPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDD
VQSIDWLRDGVKLAESNRTRITGEEVEVWDSVPADSGLYACVTSSPLGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIIYKMKSSTKKSDFHSQMAVHKLAKS
IPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVL
GKPLGEGCFGQVVLAEAIGLDKDKPSRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK
HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDL
VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNG
RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMD
KPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSF
PDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR
NT seq 2469 nt   +upstreamnt  +downstreamnt
atgtggagctggaagtgcctcctcttctgggctgtgctggtcacagccacactctgcact
gctaggccggccccgaccttgcctgaacaagcccagccctggggagcccctgtggaagta
gagtccttcctggtccaccctggtgacctactgcagcttcgctgtcggctgcgtgacgat
gtgcagagcatcgactggctgcgggacggggtgaaactggcagaaagcaaccgcacccgc
atcacaggggaggaggtggaggtgtgggactccgtgcccgcggactccggcctctatgct
tgcgtgaccagcagccctttgggcagcgacaccacctacttctccgtcaatgtttcagat
gctctcccctcctcggaggatgatgatgatgatgatgactcctcttcagaggagaaagag
acagataacaccaaaccaaaccgtatgcctgtagctccatattggacatccccagaaaag
atggaaaagaaattgcatgcggtgccagctgccaagacagtgaagttcaaatgcccttcc
agtgggaccccaaaccccacactgcgctggttgaaaaatggcaaagaattcaaacctgat
cacaggattggaggctacaaggtccgttatgccacctggagcatcataatggactccgtg
gtgccctctgacaagggcaactacacctgcatcgtggagaatgagtacggcagcatcaac
cacacctaccagcttgatgtcgtggagcggtcccctcaccggcccatcctgcaagcaggg
ttgcccgccaacaagacagtggccctgggtagcaacgtggagttcatgtgtaaggtgtac
agtgacccacaaccacacatccagtggctaaagcacatcgaggtgaacgggagcaagatt
ggtccagacaacctgccttatgtccagatcttgaagactgctggagtgaataccaccgac
aaagagatggaggtgcttcacttaagaaatgtctcctttgaggacgcaggggagtatacg
tgcttggcgggtaactctatcggactctcccatcactctgcatggttgaccgttctggaa
gccctggaagagaggccagccgtgatgacctcacccttgtacctggagatcatcatctat
tgcacaggggccttcctcatctcctgcatggtggggtcggtcatcatctacaagatgaag
agcagcaccaagaagagtgacttccacagccagatggccgtgcacaagctggccaagagc
atccctctgcgcagacaggtaacagtgtccgctgactccagtgcgtccatgaactctggg
gttcttctggttcggccatcacggctctcctccagtgggactcccatgctagcaggggtc
tctgagtatgagcttcccgaagaccctcgctgggagctgcctcgggacagactggtctta
ggaaaacccctgggagagggctgctttgggcaggtggtattggcagaggccatcggactg
gacaaggacaaacccagccgtgtgaccaaggtggctgtgaagatgttgaagtcggatgca
acagagaaagacttgtcagacctgatctcagaaatggagatgatgaagatgatcgggaag
cataagaacatcatcaacctactgggggcctgcacgcaggatggtcccttgtatgtcatc
gtggagtatgcctccaaaggcaacctgcgggagtacctgcaggcccggaggcccccgggg
ctggaatactgctacaaccccagccacaacccagaggagcagctctcctccaaggacctg
gtgtcctgcgcctatcaggtggcccgaggcatggagtatctggcctccaagaagtgcata
caccgagacctggccgccaggaacgtcctggtgacagaggacaacgtgatgaagattgca
gacttcggcctcgcacgggacattcaccacatcgactactataaaaagacaaccaacggc
cgactgcctgtgaagtggatggcacccgaggcattgtttgaccggatctacacccaccag
agtgatgtgtggtcttttggggtgctcctgtgggagatcttcactctgggcggctcccca
taccccggtgtgcctgtggaggagcttttcaagctgctgaaggagggtcaccgcatggac
aagcccagtaactgcaccaacgagctgtacatgatgatgcgggactgctggcatgcagtg
ccctcgcagagacccaccttcaagcagctggtggaagatctggaccgcatagtggccttg
acctccaaccaggaatacctggacctgtccatgcccctggaccagtactcccccagcttt
cctgacacccggagctctacgtgctcctcaggggaggattccgtcttttctcatgagccg
ctgcctgaggagccctgcctgccccgacacccagcccagcttgccaatggcggactcaaa
cgccgctga

DBGET integrated database retrieval system