KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390206
Entry
100390206         CDS       T03264                                 

Gene name
CRKL
Definition
(RefSeq) CRK like proto-oncogene, adaptor protein
  KO
K04438  C-crk adapter molecule crk
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04015  Rap1 signaling pathway
cjc04062  Chemokine signaling pathway
cjc04510  Focal adhesion
cjc04666  Fc gamma R-mediated phagocytosis
cjc04722  Neurotrophin signaling pathway
cjc04810  Regulation of actin cytoskeleton
cjc04910  Insulin signaling pathway
cjc04935  Growth hormone synthesis, secretion and action
cjc05100  Bacterial invasion of epithelial cells
cjc05135  Yersinia infection
cjc05163  Human cytomegalovirus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05206  MicroRNAs in cancer
cjc05211  Renal cell carcinoma
cjc05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100390206 (CRKL)
   04012 ErbB signaling pathway
    100390206 (CRKL)
   04015 Rap1 signaling pathway
    100390206 (CRKL)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100390206 (CRKL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100390206 (CRKL)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100390206 (CRKL)
   04062 Chemokine signaling pathway
    100390206 (CRKL)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100390206 (CRKL)
   04935 Growth hormone synthesis, secretion and action
    100390206 (CRKL)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100390206 (CRKL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100390206 (CRKL)
   05206 MicroRNAs in cancer
    100390206 (CRKL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100390206 (CRKL)
   05211 Renal cell carcinoma
    100390206 (CRKL)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100390206 (CRKL)
   05100 Bacterial invasion of epithelial cells
    100390206 (CRKL)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100390206 (CRKL)
   05163 Human cytomegalovirus infection
    100390206 (CRKL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:cjc04990]
    100390206 (CRKL)
Domain-containing proteins not elsewhere classified [BR:cjc04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   100390206 (CRKL)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 hSH3
Other DBs
NCBI-GeneID: 100390206
NCBI-ProteinID: XP_017833667
Ensembl: ENSCJAG00000015862
UniProt: F7HYH0
LinkDB
Position
1
AA seq 303 aa
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPSLPT
AEENLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPD
ENE
NT seq 912 nt   +upstreamnt  +downstreamnt
atgtcctccgccaggttcgactcctcggaccgctctgcctggtacatggggccggtgtct
cgccaggaggcgcagacccggctccagggccagcgtcacggtatgttcctcgtccgcgac
tcttccacctgccctggggactatgtgttgtcggtgtccgagaactcgcgggtctcccac
tacatcatcaactcgctgcccaaccgccgttttaagatcggggaccaggagtttgaccat
ttgccggccctgctggagttttacaagatccactacctggacaccaccacgctcatcgag
cccgcgcccaggtatccaagcccaccaatgggatctgtctcagcacccagcctgcctaca
gcagaggaaaacctggaatatgtacggactctgtatgattttcctggaaatgatgcagaa
gacttgccctttaaaaagggtgagatcttagtgataatagagaagcctgaagaacaatgg
tggagtgcccggaacaaggatggccgggttgggatgattcctgtcccttatgtcgaaaag
cttgtgagatcctcaccacacggaaagcatggaaataggaattccaacagttatgggatc
ccagaacctgctcatgcgtacgcccaacctcagaccacaactcctctacctgcagtttcc
ggttctcctggggcagcaatcacccctttgccatccactcagaatggacctgtctttgcg
aaagcaatccagaaaagagtaccctgtgcttatgacaagactgccttggcattagaggtt
ggtgacattgtgaaagtcacaaggatgaatataaatggccagtgggaaggcgaggtgaat
gggcgcaaaggtcttttcccctttacgcacgtcaaaatctttgaccctcaaaacccagat
gaaaatgagtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399916
Entry
100399916         CDS       T03264                                 

Gene name
CRK
Definition
(RefSeq) CRK proto-oncogene, adaptor protein
  KO
K04438  C-crk adapter molecule crk
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04015  Rap1 signaling pathway
cjc04062  Chemokine signaling pathway
cjc04510  Focal adhesion
cjc04666  Fc gamma R-mediated phagocytosis
cjc04722  Neurotrophin signaling pathway
cjc04810  Regulation of actin cytoskeleton
cjc04910  Insulin signaling pathway
cjc04935  Growth hormone synthesis, secretion and action
cjc05100  Bacterial invasion of epithelial cells
cjc05135  Yersinia infection
cjc05163  Human cytomegalovirus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05206  MicroRNAs in cancer
cjc05211  Renal cell carcinoma
cjc05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100399916 (CRK)
   04012 ErbB signaling pathway
    100399916 (CRK)
   04015 Rap1 signaling pathway
    100399916 (CRK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100399916 (CRK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100399916 (CRK)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100399916 (CRK)
   04062 Chemokine signaling pathway
    100399916 (CRK)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100399916 (CRK)
   04935 Growth hormone synthesis, secretion and action
    100399916 (CRK)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100399916 (CRK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100399916 (CRK)
   05206 MicroRNAs in cancer
    100399916 (CRK)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100399916 (CRK)
   05211 Renal cell carcinoma
    100399916 (CRK)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100399916 (CRK)
   05100 Bacterial invasion of epithelial cells
    100399916 (CRK)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100399916 (CRK)
   05163 Human cytomegalovirus infection
    100399916 (CRK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:cjc04990]
    100399916 (CRK)
Domain-containing proteins not elsewhere classified [BR:cjc04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   100399916 (CRK)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 SH3_10 DUF3804
Other DBs
NCBI-GeneID: 100399916
NCBI-ProteinID: XP_002747868
Ensembl: ENSCJAG00000002099
UniProt: F7DT53
LinkDB
Position
5
AA seq 304 aa
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPSGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcgggcaacttcgactcggaggagcggagtagctggtactgggggcgtctgagtcgg
caggaggcggtggcgctgctgcagggccagcggcacggggtcttcctggtgcgggactcg
agcaccagccccggggactatgtactcagcgtgtccgagaactcgcgcgtctcccactac
atcatcaacagcagcggcccgcgcccgccggtgccgccgtcgcccgcgcagccgccgtcc
ggggtgagcccctccagactccgaataggagatcaagagttcgattcattgcctgcttta
ctggaattctacaaaatacactatttggacactacaacgttgatagaaccggtttccaga
tccaggcagggtagtggagtgattctcaggcaggaggaggcggagtatgtgcgagccctc
tttgactttaatgggaatgatgaagaagatcttccctttaagaaaggagacatcctgaga
atccgggataagcctgaagagcagtggtggaatgcggaggacagcgaaggcaagaggggg
atgatcccggtcccttacgtcgagaagtatagacctgcctccgcctcagtgtcggctctg
attggaggtaaccaggagggttcccacccgcagccactgggtgggccggagccggggccc
tatgcgcaacccagcgtcaacactccgcttcctaacctccagaatgggcccatatatgcc
agggttatccagaagcgagtccccaatgcctacgacaagacagccttggctttggaggtc
ggtgagctggtaaaggttacgaagattaatgtgagtggtcagtgggaaggggagtgcaat
ggcaaacgaggtcacttccctttcacacatgttcgtctgctggatcaacagaatcccgat
gaggacttcagctga

DBGET integrated database retrieval system