KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390871
Entry
100390871         CDS       T03264                                 

Gene name
KL
Definition
(RefSeq) klotho
  KO
K14756  klotho [EC:3.2.1.31]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00040  Pentose and glucuronate interconversions
cjc00053  Ascorbate and aldarate metabolism
cjc01100  Metabolic pathways
cjc04211  Longevity regulating pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04961  Endocrine and other factor-regulated calcium reabsorption
Module
cjc_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100390871 (KL)
   00053 Ascorbate and aldarate metabolism
    100390871 (KL)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100390871 (KL)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100390871 (KL)
  09149 Aging
   04211 Longevity regulating pathway
    100390871 (KL)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.31  beta-glucuronidase
     100390871 (KL)
Transporters [BR:cjc02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   100390871 (KL)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100390871 (KL)
SSDB
Motif
Pfam: Glyco_hydro_1
Other DBs
NCBI-GeneID: 100390871
NCBI-ProteinID: XP_017827257
Ensembl: ENSCJAG00000018421
LinkDB
Position
5
AA seq 1019 aa
MTQERLQLTKDQEQEDLRAAVAKAVEKVCSVQCPALTSRQYSITEETQLGFDLATSFPRD
RNVLQDTFPDGFLWAVGSAAYQTEGGWRQHGKGASIWDTFTHHPLAPLGKPRVANLSSGT
PPPLPPATGDVASDGYNNVFRDTEALRELGVTHYRFSISWARVFPNGSSGAPNREGLRYY
RRLLERLRELGVQPVVTLYHWDLPQHLQDVYGGWANRALTDHFRDYAELCFRHFGGQVKY
WITIDNPYVVAWHGYATGRLAPGIRGSPRLGYLVAHNLLLAHAKIWHLYNTSFRPTQGGQ
VSIALSSHWIIPQSMTNHNIKECQKSLDFVLGWFAKPIFIDGDYPESMKNNLSSLLPNFT
ESEKKFVNGTADFFALSFGPTLSYQLVDPHMKFHQLESPSLRQLLSWIDLEYNHPQIFIV
ENGWFVSGTTKRDDAKCMYYLKKFIMETLKAIKLDGVDVIGYTAWSLMDGFEWHRGYSIR
RGLFYVDFLSHNKTSLPKSSALFYQKLIEKNGFPPLPENRPIEGTFPCDFAWGIVDNYIQ
VDTTLSQFTDPNVYLWDVHRSKRLIKVDGAVTKKRKSYCVDFAAIRPQIGLLQEMHVTHF
RFSLDWALILPLGNQSQVNHTILHYYRCMVSELVRANITPVVALWQPSTPNQGLPRPLAR
QGAWENPYTALAFAEYARLCFQELGRHVKLWITMNEPQTRDMTFSAGHNLLKAHALAWHI
YDEKFRHAQNGKISIALQADWLEPACPFSQKDKEATKRVLEFDIGWLAEPIFGSGDYPWV
MRDWLNQRNNFHLPYFTEDEKKLIQGTFDFLALSHYTTILVDSEKEDPAKYNNYLEVQEM
TDTTWLNSPSQVAVVPWGLRKVLNWLKLKYGDIPMYIISNGIDDGLYAEHDQLRVYYMQN
YINEALKAYVLDGINLCGYFAYSFNDRTAPKFGLYRYAADQFEPKPSMKHYRKIIDSNGF
PGLETPEKFCPEEFTVCTDCGSFHTRKSLLGFIVFLVFAFIISLSLIFYYSKKGRRSYK
NT seq 3060 nt   +upstreamnt  +downstreamnt
atgacccaggagaggctgcagctgacaaaagaccaagaacaagaggatctaagagctgct
gtggccaaagccgtcgagaaagtctgctcagtgcaatgccctgctctcacttcccgccag
tattccattacggaggaaacacaacttggattcgatctcgctacctccttcccccgagac
cgcaatgtattgcaggacaccttcccagacggcttcctgtgggccgtgggcagcgccgcc
taccagaccgagggcggctggcggcagcatggcaagggtgcgtccatctgggacacgttc
acccaccacccgctggcgcccctgggaaaaccccgggtcgccaatctgtcgtcgggcacc
ccgccgccgctcccacccgccaccggggacgtggccagcgacggctacaacaacgtcttc
cgcgacacagaggcgctgcgcgagctcggggtcacccactaccgcttctccatctcgtgg
gcgcgggtgttccccaatggcagctcgggcgcccccaaccgcgaggggctgcgctactat
cggcgcctgctggagcggctgcgggagctaggcgtgcagccggtagtcacgctgtaccac
tgggacctgccccagcacctgcaggacgtctacggcggctgggccaaccgtgccctcacc
gaccacttcagggattacgcggagctctgcttccgccacttcggcggccaggtcaagtac
tggatcaccatcgacaacccctacgtggtggcctggcacggctatgccaccgggcgcctg
gcccccggcatccggggcagcccacggctcgggtacctggtggcgcacaacctcctcctg
gctcatgccaaaatctggcatctctacaatacttctttccgtcccactcagggaggccag
gtgtccattgccctaagctctcactggatcattcctcaaagtatgaccaaccacaacatc
aaagaatgtcaaaaatctctggattttgtactaggctggtttgccaaacccatatttatc
gatggtgactatcccgagagcatgaagaataacctttcatctcttctgcctaattttact
gaatctgagaaaaaattcgtcaatggaactgctgacttttttgctctttcctttggaccg
accttgagctatcaacttgtggaccctcacatgaaattccaccaattggaatctcccagc
ctgaggcaactgctttcctggattgatcttgaatataatcatcctcaaatatttattgtg
gaaaatggctggtttgtctcagggaccaccaagagagatgatgccaaatgtatgtattac
ctcaaaaagttcatcatggaaaccttgaaagccatcaagctggatggggtggatgtcatc
gggtacactgcatggtcactcatggatggttttgagtggcacagaggttacagcatcagg
cgtggactcttctatgtcgattttctaagccacaacaagacgtcgttgccaaagtcttca
gccttattctaccaaaagctgatagagaaaaatggctttcctcctttacctgagaatcga
cccatagaagggacatttccctgtgactttgcttggggaattgttgacaactacattcaa
gtagataccactctgtctcagtttaccgacccgaatgtgtacctgtgggatgtccaccgc
agcaaaaggcttattaaagtggacggggctgtgaccaagaagagaaaatcctattgtgtt
gactttgctgccatccggccccagattggtttgctgcaggaaatgcatgttacccatttt
cgcttctccttggactgggccctgatcctgcctctgggtaaccagtcacaggtgaaccac
accatcctgcactactatcgctgcatggtcagcgagctcgtccgtgccaacatcaccccg
gtggtggccctgtggcagccttcgaccccaaaccaaggactcccgcggcccctggccagg
cagggtgcctgggagaacccctacactgccctggcctttgcggagtatgcccgactgtgc
tttcaagagcttggccggcacgtcaagctttggataacgatgaatgagccacagacaagg
gacatgacattcagtgccggccacaaccttctgaaggcccatgccctggcttggcatata
tacgatgaaaagtttaggcatgctcagaacgggaaaatatccatagccttgcaggctgat
tggctagaacctgcctgccctttctcccaaaaggacaaagaagcgaccaagagagttttg
gaatttgacattggctggctggccgagcccattttcggctctggagattatccatgggtg
atgagggactggctgaaccaaagaaacaattttcatcttccatatttcactgaagatgaa
aaaaagctaatccagggtacatttgactttttggctttaagccattacaccaccatcctt
gtagactcggaaaaggaagatccagcaaaatataacaattacctagaagtgcaagagatg
accgacaccacgtggctcaactcccccagtcaggtggcggtagtgccctgggggttgcgc
aaagtgctgaactggctgaagctgaagtacggagacatccccatgtacataatatccaac
ggaatcgacgacgggctgtacgctgagcacgaccagctgagggtgtattatatgcagaat
tacataaacgaagctcttaaagcctacgtactggatggtatcaatctgtgcggatatttt
gcgtactcgtttaacgatcgcacagctccgaagtttggcctctatcgttacgctgcagat
cagtttgagcccaaaccatccatgaaacattacaggaaaattatcgacagcaatggtttc
ccgggcctagaaactccggaaaaattttgtccggaagaattcaccgtgtgtactgactgc
ggttcttttcacacccgaaagtccttactgggtttcattgtttttctggtttttgctttt
attatttctctctcccttatattttactactcaaagaaaggcagaagaagttacaaatag

DBGET integrated database retrieval system