KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391138Help
Entry
100391138         CDS       T03264                                 

Gene name
KMT2A, MLL
Definition
(RefSeq) lysine methyltransferase 2A
  KO
K09186  histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00310  Lysine degradation
cjc04934  Cushing syndrome
cjc05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100391138 (KMT2A)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100391138 (KMT2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100391138 (KMT2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100391138 (KMT2A)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100391138 (KMT2A)
Enzymes [BR:cjc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100391138 (KMT2A)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    100391138 (KMT2A)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100391138 (KMT2A)
   HMT complexes
    MLL-HCF complex
     100391138 (KMT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FYRC SET FYRN PHD zf-CXXC zf-HC5HC2H zf-HC5HC2H_2 PHD_2 Bromodomain PHD_4
Motif
Other DBs
NCBI-GeneID: 100391138
NCBI-ProteinID: XP_017833060
Ensembl: ENSCJAG00000013288
LinkDB All DBs
Position
11
AA seq 4004 aa AA seqDB search
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAV
AAAAAAAGSSGAGVPGGAAAASAASSSSASSSSSSSSSASSGPALLRVGPGFDAAMQVSA
AIGTNLRRFRAVFGESGGGGGSGELTTQIPCSWRTKGLIHDKKTEPFRLLAWSWCLNDEQ
FLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPRSGSDRNSAILSDPSVFSPLNKSETKSG
DKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQA
TKIKKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKP
QKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRIIPSSKRTDATIAKQLLQRAKKGAQKKI
EKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTP
NSRFSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTP
EVHTPLPISQSPENESNDRRSRRYSVSERSFGSRTTKKLSTLQSAPQQQTSSSPPPPLLT
PPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRS
EPQYFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTR
FDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSNRTSAGTSSSGVSNRKRKRKVFSPIRSE
PRSPSHSMRTRSGRLSTSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSG
ESAEKNQRPRKQTSAPPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKVPEELSKDRDADK
SVEKDKSRERDREREKENKRESRKEKRKKGSEIQSSSALYPVGRVSKEKVVGEDVATSSS
AKKASGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKE
KTLCLSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQT
DQPKAQGQESDSSETSVRGPRIKHVCRRAAVALGRKRAVFPDDMPTLSALPWEEREKILS
SMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPED
CGICTNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKK
ENKESNVVKNVVDTSQKPTPSAREDPAPKKSSSEPALRKPVEEKREEGNVSTPGPESKQV
TTPASRKSSKQVSQPAPVIPSQPPSTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKK
VAPRPSIPVKQKPKEKEKPPPVSKQENAGTLNILSTLSNGNSSKQKIPTDGVHRIRVDFK
EDCEAENVWEMGGLGILTSVPITPRVVCFLCASSGHVEFVYCQVCCEPFHKFCLEENERP
LEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWI
CTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMM
QCGKCDRWVHSKCENLSGTEDEMYEILSNLPESVAYTCVNCTERHPAEWRLALEKELQIS
LKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQ
QPLDLEGVKRKMEQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQME
RVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREENSHTEQPPLMKKI
IPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDS
ANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATV
GCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGFEVFRRVFVDFEG
ISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARK
RCVYTCKIVECRPPVVEPDINSTVEHDENRTIAHSPTSFTECSKESQNTAVIVSPPSPDR
PPHSQASGSCYYHVISKVPRIRTPSYSPAQRSPGCRPLPSAGSPTPTTHEIVTVGDPLLS
SGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNSVSSVSTVGTASDLESSAKAVD
HVLGPLNSSTSLGQNTSTSSNLQRTVVTIGNKNSHLDGSSSLEMKQSSASDLATKSSSLK
GEKTKALSSKSSEGSAHNVAYSGIPKLAPQVHNTASRELNVSKIGSFAEPSSVSFSSKES
LSFPQLHLRGQRNDRDQHADSTQLANPSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRD
RRQKGKKSCKETFKEKHSSKSFLEPGQVTTGEEGNLKPEFIDEVLTPEYMGQRPCNNVSS
DKIGDKAISMPGVPKVPSMQVEGSTKELQAPRKRTVKVTLTPLKMENESQSKNALKESSP
ASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGP
KPQEDGSFKRRYPRRSARARSNMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQ
VDGADDLSTSDEDDLYYYNFTRTVISSSGEERLASHNLFREEEQCDLPKISQLDGVDDGT
ESDTSVTATTRKSSQIPKRNSKENGTENLKIDRPEDAGEKEHVIKSSVGHKNEPKMDNCH
SVSRVKTQGQDSLEAQLSTLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNI
LPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDMGLFEVFSQQLPTT
EPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITE
KSVASSEGDPALLSPGVDPAPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTR
SSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTPPHLKPATEKLIVVNQN
MQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGSGLTLTTGLNPSLPTSQS
LFPSASKGLLPMSHHQHLHSFPAATQSSFPPNIGNPPSGLLIGVQPPPDPQLLVSESSQR
TDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSNMTLINFTPSQLSN
PNLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEQAPLLPQSVGGTAATAAGTSTISQDTSH
LTSGSVSGLASSSSVLNVVSMQTTTTPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIKA
SQQSLGIQEQPVALPPSSGMFPQLGTSQTPSTAAMTAASSICVLPSTQTTGITAASPSGE
ADEHYQLQHVNQLLASKSGMHSSQRDLDSTSGPQVSNFTQTVDTHNSVGLEQNKALSSAV
QASSTSPGGSPSSPSSGQRSASPSVPGPTKSKPKIKRIQPPLDKGNGKKHKVSHLRTSSS
EAHIPDQEATSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQVAVLPEVQVTQNPAN
EQESTEPKTVEEEESNFSSPLMLWLQQEQKRKESIAERKPKKGLVFEISSDDGFQICAES
IEDAWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKF
RFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEYNPNDEEEEEVQLKS
ARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRS
IQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKH
IVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN
NT seq 12015 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacagctgtcggtggcgcttccccgcccgacccgggaccaccgggggcggcggc
ggcggggggcgccggggcctagggggcgccccgcggcaacgcgtcccggccctgctgctt
ccccccgggcccccggtcggcggtggcggccccggggcgcccccctcccccccggctgtg
gcggccgcggcggcggcggcgggaagcagcggggctggggttccagggggagcggccgcc
gcctcagcagcctcctcgtcgtccgcctcgtcttcgtcttcgtcatcgtcctcagcctct
tcagggccggccctgctccgggtgggcccgggattcgacgcggcgatgcaggtctcggcc
gccatcggcaccaacctgcgccggttccgggccgtgtttggggagagcggcgggggaggc
ggcagcggagagctaacaacacagatcccatgtagttggagaaccaaaggcctcatacat
gacaaaaagactgaaccgttcaggttacttgcatggagttggtgcttaaatgatgagcaa
ttcttaggttttggctcagatgaagaagtcagagtgcgaagtcccacaaggtctccttca
gttaaaactagtcctcgaaaacctcgtgggagacctagaagtggctctgaccgaaattca
gctatcctctcagatccatctgtgttttcccctctaaataaatcagagaccaaatctgga
gataagatcaagaagaaagattctaaaagtatagaaaagaagagaggaagacctcccacc
ttccctggagtaaaaatcaaaataacacatggaaaggacatttcagagttaccaaaggga
aacaaagaagatagcctgaaaaaaattaaaaggacaccttctgctacgtttcagcaagcc
acaaagattaaaaaattaagagcaggtaaactctctcctctcaagtctaagtttaagaca
gggaagcttcaaataggaaggaagggggtacaaattgtacgacggagaggaaggcctcca
tcaacagaaaggataaagaccccttcgggtctcctcattaattctgaactggaaaagcct
cagaaggtccggaaagacaaggaaggaacacctccactcacaaaagaagataagacagtt
gtcagacaaagccctcgaaggattaagccagttaggattattccttcttcgaaaaggaca
gatgcaaccattgctaagcaactcctgcagagggcaaaaaagggggctcaaaagaaaatt
gaaaaagaagcagctcagctgcagggaagaaaggttaagacacaggtaaaaaatatccga
cagttcatcatgcctgttgtcagtgctatctcctcgcggatcattaagacccctcggcgg
tttatagaggatgaggattatgaccctccaattaaaattgcccgattagagtctacaccg
aatagtagattcagtgccccatcctgtggatcttctgaaaaatcaagtgcagcttctcag
cactcctctcaaatgtcttcagactcctcccgatctagtagccccagtgttgatacctcc
acagactctcaggcttctgaggagattcaggtacttcctgaagagcggagcgatacccct
gaagttcatactccactgcccatttcccagtccccagaaaatgagagtaatgataggaga
agcagaaggtattcagtgtcggagagaagttttggatctagaacgacgaaaaaactatca
actctacaaagtgccccccagcagcagacctcctcttctccacctccacctctgctgact
ccacccccaccactgcagccagcctccagtatctctgaccacacaccttggcttatgcct
ccaacaatccccttagcatcaccatttttgcctgcttccactgctcctatgcaagggaag
cgaaaatctattttgcgagaaccgacatttaggtggacttctttaaagcattctaggtca
gagccacagtacttttcctcagcaaagtatgccaaagaaggtcttattcgcaaaccaata
tttgataatttccgaccccctccgctaactcccgaggacgttggctttgcgtctggtttt
tctgcatctggtactgctgcttcagcccgattgttttcgccactccattctggaacaagg
tttgatatgcacaaaaggagccctcttctgagagctccaagatttactccaagtgaggct
cactctagaatatttgagtctgtaaccttgcctagtaatcgaacttctgctggaacatct
tcttcaggagtatccaatagaaaaaggaaaagaaaagtgtttagtcctattcgatctgaa
ccaagatctccttctcactccatgaggacaagaagtggaaggcttagtacttctgagctg
tcacctctcacccccccgtcttctgtctcttcctcattaagcatttctgttagtcctctt
gccactagtgccttaaacccaacttttacttttccttctcattccctgactcagtctggg
gaatctgcagagaaaaatcagagaccaaggaagcagactagtgctcctccggcagagccg
ttttcatcaagtagtcctactcctctcttcccttggtttaccccaggctctcagactgaa
agagggagaaataaagacaaggtccctgaggagctgtccaaagatcgagatgctgacaag
agcgtggagaaggacaagagtagagagagagaccgggagagagaaaaggagaataagcgg
gagtcaaggaaagagaaaaggaaaaagggatcagaaattcagagtagttctgctttgtat
cctgtgggtagggtttccaaagagaaggttgttggtgaagatgttgccacttcatcttct
gccaaaaaagcatcagggcggaagaagtcttcatcacatgattctgggactgatattact
tctgtgactcttggggatacaacagctgtcaaaaccaaaatacttataaagaaagggaga
ggaaatctggaaaaaaccaacttggacctcggcccaactgccccatccctggagaaggag
aaaaccctctgcctttccactccttcatctagcactgttaaacattccacttcctccata
ggctccatgttggctcaggcagacaagcttccaatgactgacaagagggttgccagcctc
ctaaaaaaggccaaagctcagctctgcaagattgagaagagtaagagtcttaaacaaact
gaccagcccaaagcacagggtcaagaaagtgactcatcagagacctctgttcgaggaccc
cggattaaacatgtctgcagaagagcggctgttgcccttggccgaaaacgagctgtgttt
cctgatgacatgcccaccctgagtgccttaccatgggaagaacgagaaaagattttgtct
tccatggggaatgatgacaagtcatcaattgctggctcagaagatgctgaacctcttgct
ccacccatcaaaccaattaaacctgtcactagaaacaaggcgccccaggaacctccagta
aagaaaggacggcgatcgaggcggtgtgggcagtgtcccggctgccaggtgcctgaggac
tgtggtatttgtactaattgcttagataaacccaagtttggtggccgcaatataaagaag
cagtgctgcaagatgagaaaatgtcagaatctacaatggatgccttccaaagcctacctg
cagaagcaagctaaagctgtgaaaaagaaagagaaaaagtctaagaccagtgaaaagaaa
gagaacaaagagagcaatgttgtgaagaacgtggtagacactagtcagaaacctacccca
tcagcaagagaggatcctgccccaaagaaaagcagtagtgagcctgctctgcgaaagcct
gtggaagaaaagcgtgaagaagggaatgtctccacccctgggcctgaatccaaacaggtc
accactccagcttccaggaagtcaagcaagcaggtctcccagccagcaccagtcatcccc
tctcagccacctagtacaggaccgccaagaaaagaagttcccaagaccactcctagtgag
cccaagaaaaagcagcctccaccaccagaatcaggtccagagcagagcaaacagaaaaaa
gtggctccccgcccaagtatccctgtaaaacaaaaaccaaaagaaaaggaaaaaccacct
ccggtcagtaagcaggagaatgcaggcactttgaacatcctcagcactctctccaatggc
aatagttctaagcaaaaaattccaacagatggagtccacaggatcagagtggactttaag
gaggactgtgaagcagaaaatgtatgggagatgggaggcttaggaatcttgacctctgtt
cctataacacccagggtggtttgctttctctgtgccagtagtgggcacgtagagtttgtg
tattgccaagtctgttgcgagcccttccacaagttttgtttagaggagaacgagcgccct
ctggaggaccagctggaaaattggtgttgtcgtcgctgcaaattctgtcacgtttgtgga
aggcaacatcaggctacaaagcagctgctggagtgtaataagtgccgaaacagctatcac
cctgagtgcctgggaccaaactaccccaccaaacccacaaagaaaaagaaagtttggatc
tgtaccaagtgtgttcgctgtaagagctgtggatccacaactccaggcaaagggtgggat
gcacagtggtctcacgatttctcactgtgccatgattgcgccaagctctttgctaaagga
aacttctgccctctctgtgacaaatgttatgatgatgatgactatgagagtaagatgatg
cagtgtgggaagtgtgatcgctgggtccattccaaatgtgagaatctttcaggtacagaa
gatgaaatgtatgagattctatctaatctgccagaaagtgtggcctacacttgtgtgaac
tgtactgagcggcaccctgcagagtggcgactggcccttgaaaaagagctgcaaatttct
ctgaagcaagttctgacagctttgttgaattctcggactaccagccatttgctacgctac
cggcaggctgccaagcctccagacttaaatcccgagacagaggagagtataccttcccgc
agctcccccgaaggaccagatccaccagttcttactgaggtcagcaaacaggatgatcag
cagcctttagatctggaaggagtcaagaggaaaatggaacaagggaattacacatctgtg
ttggagttcagtgatgatattgtgaagatcattcaagcagccattaattcagatggagga
cagccagaaattaaaaaagccaacagcatggtcaagtccttcttcattcggcaaatggaa
cgtgtttttccatggttcagtgtcaaaaagtccaggttttgggagccaaataaagtatca
agcaacagtgggatgttaccaaacgcagtgcttccaccttcacttgaccataattatgct
cagtggcaggagcgagaggaaaacagccacactgaacagcctcctttaatgaagaaaatc
attccagctcccaaacctaaagggcctggagaaccagactcaccaactcctctgcatcct
cctacgccaccaattttgagtactgataggagtcgagaagacagtccagagctgaaccca
cccccgggcatagaagacaatagacagtgtgcgttatgtttgacatatggtgatgacagt
gctaatgatgctggtcgtttgctatatattggtcaaaatgagtggacacatgtaaattgt
gctttatggtcagcggaagtgtttgaagatgatgacggatcgctaaagaatgtgcatatg
gctgtgatcaggggcaagcagctgagatgtgaattctgccaaaagccaggagccaccgtg
ggttgctgcctcacatcctgcacgagcaactatcacttcatgtgttcccgagccaagaac
tgtgtctttctggatgataaaaaagtatattgccaacgacatcgggatttgatcaaaggc
gaagtggttcctgagaatggatttgaagttttcagaagagtgtttgtggactttgaagga
atcagcttgagaaggaagtttctcaatggcttggaaccagaaaatatccacatgatgatt
ggctccatgacaatcgactgtttaggaattctaaatgatctctctgactgtgaagataag
ctctttcctatcggatatcagtgttccagggtatattggagcaccacagatgctcgcaag
cgctgtgtatatacgtgcaagatagtggagtgccgtcctccagtcgtagagccagatatc
aacagcactgttgaacatgatgaaaatagaaccattgcccatagtccaacatcttttaca
gaatgttcaaaagagagtcaaaacacagctgtaattgtaagtcctccatcaccagaccga
cctcctcattcgcaagcctctggctcctgttattatcatgtcatctcaaaggtccctagg
attcgaacacccagttattctccagcacagagatcccctggctgtcgaccattgccttct
gcaggaagtcctactccaaccactcatgaaatagtcacagtgggcgatcctctactctcc
tctggacttcgaagcattggctccagacgtcacagtacctcttccttatcaccccagcgg
tccaaactccggataatgtctccaatgagaactgggaatacttactctaggaatagtgtt
tcctcagtctccaccgttgggaccgcttctgatcttgaatcaagtgccaaagcagttgat
catgtcttagggccactgaattcaagtactagtttagggcagaacacttccacctcttca
aatttgcaaaggactgtggttaccataggcaataaaaacagtcacttggatggatcttca
tctttagaaatgaagcagtccagtgcttcagatttggcaaccaagagctcctctttaaag
ggagagaagaccaaagcgctgagttccaagagctcagaaggatctgcgcataatgtggct
tactctggaattcctaaactggccccgcaggttcataacacagcatctagagaactgaat
gttagtaaaattggctcctttgctgagccttcttcggtgtcattttcttctaaagagtcc
ctctccttcccacaactccatttgagggggcaaaggaatgatcgagaccaacacgcagat
tctacccaattagcaaacccctctccagatgaagatactgaagtcaaaaccttgaagcta
tctggaatgagcaacaggtcatccattatcaatgaacatatgggatctagttccagagac
aggagacagaaagggaaaaaatcttgtaaagaaactttcaaagaaaagcattccagtaaa
tcttttttggaacctggtcaggtgacaactggtgaggaaggaaacctgaagccagagttt
attgatgaagttttgactcctgaatatatgggccaacgaccatgtaacaatgtttcttct
gataagattggtgataaagccatttctatgccaggagtccccaaagttccatccatgcaa
gtagaaggatctaccaaggaattacaggcaccgcggaaacgcacagtcaaagtgaccctg
acacctctaaaaatggaaaatgagagtcaatccaaaaacgccctgaaagaaagtagtcct
gcttcccctttgcaaatagagtcaacatctcccacagaaccaatttcagcctctgaaaat
ccaggagatggtccagtggcccaaccaagccccaataatacctcatgccaggattctcaa
agcaacaactatcagaatcttccagtacaggacagaaacctaatgcttccagatggcccc
aaacctcaggaggatggctcttttaaaaggaggtatccccgtcgcagtgcccgtgcacgt
tctaacatgttctttgggcttaccccactctatggagtaagatcctatggtgaagaagac
attccattctacagcagctcaactgggaagaaacgaggcaagagatcagctgaaggacag
gtggatggggctgatgacttaagcacctcagatgaagatgacttatactattacaacttc
actagaacagtgatttcttcaagtggagaggaacgactggcatcccataatttatttcgg
gaggaggaacagtgtgatcttccaaaaatttcacagttggatggtgttgatgatgggaca
gagagtgatactagtgtcacagccacaacaaggaaaagcagccagattccaaaaagaaac
agtaaagaaaatggaacagagaacttaaagattgatcgacctgaagatgctggggagaaa
gaacatgtcattaagagttctgttggccacaaaaatgagccaaagatggataactgccat
tctgtaagcagagttaaaacacagggacaggattccttggaagctcagctcagcacattg
gagtcaagccgcagagtccacacaagcaccccctcagacaaaaatttgctagatacctat
aatactgagctcctgaaatcagattcagacaataacaatagtgatgactgtgggaatatc
ctgccttcggacattatggactttgtactaaagaatactccatccatgcaagctttgggt
gagagcccagagtcgtcatcatcagaactcctgaatcttggtgaaggtttgggtcttgac
agtaatcgtgaaaaagatatgggtctttttgaagtattttctcagcagctgcctacaaca
gaacctgtggacagtagtgtctcttcctctatctcagcagaggaacagtttgaattgcct
ctagagctaccatctgatctctctgtcttgaccacccggagtcccactgtcccaagccag
aatcccagtagactagctgtaatctcagactcgggggagaagagagtaaccatcacagaa
aaatctgtagcctcctctgaaggtgacccagcgctgctgagcccaggagtagatccagct
cctgaaggccacatgactcctgatcattttatccaaggacacatggatgcagaccacatc
tctagccctccttgtggttcagtagagcaaggtcatggcaacaatcaggatttaactaga
agcagtagcacccctggccttcaggtacctgtttccccaactgttcctatccagaaccag
aagtatgtgcccaattctactgatagtcctggcccgtctcagatttccaatgcagctgtt
cagaccactccaccccacctgaagccagccaccgagaaactcatagttgttaaccagaac
atgcagccactttatgttctccaaactcttccaaatggagtcacccagaaaatccaattg
acctcttccgtcagttctacacccagtgtgatggagacaaatacttcagtattggggccc
atgggaagtggtctcaccctaaccacgggactgaatccaagcttgccaacttctcaatct
ttgttcccttctgctagcaaaggattgctacccatgtctcatcaccagcacttacattcc
ttccctgcagctactcaaagtagtttcccacccaacatcggcaatcctccttcaggcctg
cttattggagttcagcctcctccagatccccaacttttagtttcagaatccagccagagg
acagacctcagtaccacagtggccactccatcctccggactcaagaaaagacccatatct
cgtctacagacccgaaagaataagaaacttgctccctctagtaccccttcaaacattgct
ccttccgatgttgtttctaatatgacattgattaacttcacaccctcccagctttctaat
cccaatctgttagatttggggtcacttaatacttcctctcaccgaactgtccccaacatc
ataaaaagatctaaatctagcatcatgtattttgaacaggcacccctgttaccacagagt
gtgggaggaactgctgccacagcggcaggcacatcaacaataagccaggatactagccac
ctcacatcagggtctgtgtctggcttggcatccagttcctctgtcttgaatgttgtatcc
atgcaaactaccacaacccctacaagtagtgcatcagttccaggacatgtcaccttaacc
aacccaaggttgcttggcaccccagatattggctcaataagcaatcttttaatcaaagca
agccagcagagcctggggattcaggagcagcctgtggctttaccaccaagttcaggaatg
tttccacaactggggacatcacagactccctctactgctgcaatgaccgcagcatctagc
atctgtgtgctcccctccactcagactacgggcataacagctgcttcaccttctggggag
gcagacgaacactatcagcttcagcacgtgaaccagctccttgccagcaaatctgggatg
cattcttcccagcgtgatcttgattctacttcagggccccaggtatccaactttacccag
acagtagacactcataatagtgtgggtctggagcagaacaaggctttatcctcagctgtg
caagcaagctccacctctcctgggggttctccatcctctccatcctctggacagcggtca
gcaagcccttcagtgccaggtcccactaaatccaaaccaaaaatcaaacggattcagccg
cctctagacaaagggaatggcaagaagcacaaagtttcccatttgcggaccagttcttct
gaagcacacattccagaccaagaagcaacatccctgacctcaggcacagggactccagga
gcagaggctgagcagcaagatacagctagtgtggagcagtcctcccagaaggagtgtggg
cagcctgcagggcaagtggctgttcttccggaagttcaggtgacccaaaatccagcaaat
gaacaagaaagtacagaacctaaaacagtggaagaagaagaaagtaatttcagctctccg
ctgatgctttggcttcagcaagaacaaaagcggaaggaaagcattgctgagagaaaaccg
aagaaaggacttgtctttgaaatttccagtgatgatggctttcagatctgtgcagaaagt
attgaagatgcttggaagtcactgacagataaagtccaggaagctcgatcaaatgcccgc
ctaaagcagctctcatttgcaggtgttaacggtttgaggatgctggggattctccatgat
gcagttgtgttcctgattgagcagctgtctggtgccaagcactgtcgaaattacaaattc
cgtttccacaagccagaggaggccaatgaacccccgttgaaccctcatggctcagccagg
gctgaagtccacctcaggaagtcagcatttgacatgtttaacttcctggcttctaaacat
cgtcagcctcctgaatacaaccccaatgatgaagaagaggaggaggtacagctgaagtca
gctcggagggcaactagcatggatctgccaatgcccatgcgtttccggcacttaaaaaag
acttctaaggaggcagttggtgtctacaggtctcccatccatggccgtggtcttttctgt
aagagaaacattgatgcaggtgagatggtgattgagtatgctggcaacgtcatccgttcc
atccagactgataagcgggaaaagtattatgacagcaagggcattggttgctatatgttc
cgaattgatgactcagaggtagtggatgccaccatgcatggaaatgctgcacgcttcatc
aatcactcatgtgagcctaactgctactctcgggtcatcaatattgatgggcagaagcac
attgtcatctttgccatgcgtaagatctaccgaggagaggaactcacttatgactataag
ttccccattgaggatgccagcaacaagctgccctgcaactgtggcgccaagaaatgccgg
aagttcctaaactaa

DBGET integrated database retrieval system