KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391311
Entry
100391311         CDS       T03264                                 

Gene name
PIM1
Definition
(RefSeq) Pim-1 proto-oncogene, serine/threonine kinase
  KO
K04702  proto-oncogene serine/threonine-protein kinase Pim-1 [EC:2.7.11.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04630  JAK-STAT signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05200  Pathways in cancer
cjc05206  MicroRNAs in cancer
cjc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100391311 (PIM1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100391311 (PIM1)
   05206 MicroRNAs in cancer
    100391311 (PIM1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100391311 (PIM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100391311 (PIM1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100391311 (PIM1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100391311 (PIM1)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: CAMK group
  PIM family [OT]
   100391311 (PIM1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal APH Choline_kinase Seadorna_VP7
Other DBs
NCBI-GeneID: 100391311
NCBI-ProteinID: XP_008992604
LinkDB
Position
4
AA seq 410 aa
LRTSGLAALPHXPYELLTSLLSALPDSAGAPSRRQSRQRPQLSSDSPSAFRASRNHSRNA
TRSHSPSPRHSHRHSPGSGSCCSSSGHRPCTDILEVGMLLSKINSLAHLRAAPCNDLHAT
KLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGTRVSDNLPVAIKHVEKDRISDWGELPNG
TRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEEL
ARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDG
TRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIKGQVFFRQRVSSEC
QHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK
NT seq 1233 nt   +upstreamnt  +downstreamnt
ctacgaacctccggccttgcggcgctgccgcactagccctacgagctactcacctcgctg
ctctctgctctgccggactccgctggcgcgccctcccgccgccagtcccggcagcgccct
cagttgtcctccgactcgccctcggccttccgcgccagccgcaaccacagccgcaacgcc
acccgcagccacagccccagccccaggcatagccatcggcacagcccgggctccgggtcc
tgctgcagctcctccgggcaccgtccctgcaccgacatcctggaggttgggatgctcttg
tccaaaatcaactcgcttgcccacctgcgcgccgcgccctgcaacgacctgcacgccacc
aagctggcgcccggcaaggaaaaggagcccctggagtcgcagtaccaggtgggcccgcta
ctgggcagcggcggcttcggctcggtctactcaggcacccgcgtgtccgacaacttgccg
gtggccatcaaacacgtggagaaggaccggatctccgactggggagagctgcccaatggc
acccgagtgcccatggaagtcgtcctgctgaagaaggtgagctccggcttctccggcgtc
attaggctcctggactggttcgagaggcccgacagtttcgtcctgatcctggagaggccc
gagccggtgcaagacctcttcgactttatcacggaaagaggggctctgcaggaggagttg
gctcgcagcttcttctggcaggtgctggaggccgtgcggcactgccacaactgcggggtg
ctccaccgcgacatcaaggacgaaaacatcctcatcgacctcaatcgcggcgagctcaag
ctcatcgacttcgggtcgggggcgctgctcaaggacaccgtctacaccgacttcgacggg
acccgagtatatagccctccagagtggatccgctaccatcgctaccatggcaggtcggcg
gcggtctggtccctggggatcctgctgtatgatatggtgtgtggagatattccttttgaa
catgacgaagagatcatcaagggccaagttttcttcaggcagagggtctcttcagagtgt
cagcatctcattagatggtgcttggccctgagaccatcagataggccaaccttcgaagaa
atccagaatcatccatggatgcaagatgttctcctgccccaggaaactgctgagatccac
ctccacagcctgtcaccgggacccagcaaatag

DBGET integrated database retrieval system