KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391685
Entry
100391685         CDS       T03264                                 

Gene name
CGB, CG-beta
Definition
(RefSeq) chorionic gonadotropin, beta polypeptide
  KO
K08521  lutropin subunit beta
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04024  cAMP signaling pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04917  Prolactin signaling pathway
cjc04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100391685 (CGB)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100391685 (CGB)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100391685 (CGB)
   04912 GnRH signaling pathway
    100391685 (CGB)
   04913 Ovarian steroidogenesis
    100391685 (CGB)
   04917 Prolactin signaling pathway
    100391685 (CGB)
SSDB
Motif
Pfam: Cys_knot zf-Dof
Other DBs
NCBI-GeneID: 100391685
NCBI-ProteinID: XP_002762382
Ensembl: ENSCJAG00000000216
LinkDB
Position
22
AA seq 140 aa
MEMLQGLLLCLLLSTGGAWASKEPLRPLCRPVNAILAAEKEGCPVCVAFNTTICAGYCSS
MVRVLQTILPPLPQSVCNYHELRFTSVRLPGCRPGVDPVVSMPVALSCRCGLCRRSYSDC
GSLRNEPLGCDYXHLPGLFL
NT seq 423 nt   +upstreamnt  +downstreamnt
atggagatgctccaggggctgctgctgtgtctgctgctgagcacgggtggggcatgggca
tccaaggagccacttcggccactgtgtcgccccgtcaatgccatcctggctgctgagaag
gagggctgccctgtgtgtgtcgcctttaacaccaccatctgtgccggctactgctccagc
atggtacgggtgctgcagaccatcttaccgcccttaccccagtcggtgtgcaactaccac
gagctgcgcttcacctctgtccggctccctggctgtcggcccggcgtggatcccgtagtt
tccatgcccgtggctctcagctgtcgctgtggactctgccgccgaagctattctgactgc
gggagtctcaggaacgagcccttgggctgtgactacntccaccttccaggactcttcctc
taa

DBGET integrated database retrieval system