KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391853Help
Entry
100391853         CDS       T03264                                 

Gene name
ZFHX2
Definition
(RefSeq) zinc finger homeobox 2
  KO
K09379  zinc finger homeobox protein 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100391853 (ZFHX2)
Transcription factors [BR:cjc03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain plus zinc finger motifs
    100391853 (ZFHX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN zf-C2H2_2 zf-H2C2_5 zf-C2H2 zf-met LIM_bind zf-C2H2_4
Motif
Other DBs
NCBI-GeneID: 100391853
NCBI-ProteinID: XP_009004035
Ensembl: ENSCJAG00000007523
LinkDB All DBs
Position
10
AA seq 2577 aa AA seqDB search
MATLNSASTTGTTPSPGHNALSPPPDTSSSSTSSDPITKDPPAAPSTSENMRSSEPGGQP
LELGCGLVPPKEIGKPQEGPGCGHFSPNDLEMEKDKEQEEDEGLPPVDLSNHLFFTAGGE
AYLVAKLSLPGGSELLLPKGFPWGEVGIKEEPSLPFLAHPPPSHLTALHIQHGFDPIQGF
SSSDQILSHDTSAPSPAACEGRHGAFWSYQLAPDPAGDPKDGPVGNSGGNHVAVFWLCLL
CRLGFSKPQAFMGHTQSHGVKLTPAQHQGLSGSPAVLQEGDEGCKALISFLEPKLPARPS
SDIHLDNSSTVNMEANVAKTEDGPTEADVQALVLLDEEVMALSPPSPPTATWDPSQTQAK
ESPTSAGEAGPDWFPEGQEEDGGLCPPLNQSSPTSKEGGTLPAPVGSPEDPSDPPQPYRL
ADDYTPAPAAFQGLSLSSHMSLLHSRNSCKTLKCPKCNWHYKYQQTLDVHMREKHPESNS
HCSYCSAGGAHPRLARGESYNCGYKPYRCDVCNYSTTTKGNLSIHMQSDKHLANLQGFQA
GPGGQGSPSESSLPPSAGDKEPKTKSPWQCKVCSYETNISRNLRIHMTSEKHMQNVLMLH
QGLPLGLPPGLVGPGPPPPPGAAPTNPPELFQYFGPQALGQPQTPLPGPGLRPDKPLEAQ
LLLNGFHHLGAPARKFPTPAPGSLSPDAHLPPSQLLGSSSDSLPTSPPPDDSLSLKVFRC
LVCQAFSTDSLELLLYHCSIGRSLPEAEWKEVAGDTHRCKLCCYGTQLKANFQLHLKTDK
HAQKYQLAAHLREGGGAVGTPSPLPLGDGAPYGSISPLHLRCNICDFESNSKEKMQLHAR
GAAHEENSQIYKFLLEMEGAEARAELGLYHCLLCVWETPSRLAMLQHLRTPAHRDAQAQR
RLQLLQNGPTAEEGPEALQSILSFSHRQLQTPGKAPVTPTAEPPIPEKDAQNKTEQLASE
ETENKTGPSRDSANQTMVYCCPYCSFLSPESSQVRAHTLSQHAVQPKYRCPLCQEQLVGR
PALHFHLSHLHNVVPECVEKLLLVATTVEMTFTTKVLSGPTLSPLDDGQEPPTHGPEPTP
SRDQAAEGPNLTPEASPDSLPEPPLASAEAPDKPSGSPGQPPSPAPSPVPQPDAQVEDVA
PLPTMAEEEEGTTGERSAEPAPADPRHPLTYRKTTNFALDKFLDPARPYKCTVCKESFTQ
KNILLVHYNSVSHLHKMKKAAIDPSAPARGETGAPPTSTAATDKPFKCTVCRVSYNQSST
LEIHMRSVLHQTRSRGTKTDSKIEGPERSQEEPKEGETEGEMGTEKKGPDPSGFISGLPF
LSPPPPPLDLHRFPAPLFTPPLLPPFPLVPESLLKLQQQQLLLPFYLHDLKVGPKLTLAG
PAPMLSLPAATPPPPPPPPKAELTEQEWERPPMAKEGNEAGPSSSPHHLPNEAARTAAKP
FXKNFGLSXKTLALKLVIQYNEGKQAVPPPPTPPPPEALGGGDKLACGACGKLFSNMLIL
KTHEEHVHRRFLPFEALSRYAAQFRKSYDSLYSPPAETPRPPDGSLDSPAPQLAPPFLVP
EPEAAGTRAPEEQSRAGGRWPAEEEESSRGNIPPLLPAGRRFSRTKFTEFQTQALQSFFE
TSAYPKDGEVERLASLLGLASRVVVVWFQNARQKARKNACEGGPMPTGGGTGGASGCRRC
HATFSCVFELVRHLKKCYDDQNPEEEEEEAERGEEEEEVEEEEVEEEQSLEPPAGPEGPL
PEPPDGEELSQAEATKAGGKDPEEKPTPSPSPAHTCDQCAISFSSQDLLTSHRRLHFLPS
VQPSAPPQLLDLPLLVFGERSPLVAATSPMPGPPLKRKLEDGSLSPTGSEAGGGGEGEPP
RDKRLRTTILPEQLEILYRWYMQDSNPTRKMLDCISEEVGLKKRVVQVWFQNTRARERKG
QFRSAPGGVPSPAVKPPATATPASLPKFNLLLGKVDDGTGREAPKREAPAFPYPTATPAS
GPLTFLPPGKEATTPTPEPPLPLPPPPPPSEEEGPDDPPKASPESEACSLSAGDLSDSSA
SSLAEPESPGAGGTSGGPGGGTGVPDGMGQRRYRTQMSSLQLKIMKACYEAYRTPTMQEC
EVLGEEIGLPKRVIQVWFQNARAKEKKAKLQGAATGSNGVSSEGPLAAQRTDCPYCDVKY
DFYVSCRGHLFSRQHLAKLKEAVRAQLKSESKCYDLAPAPEAPPAPKAPPATTPASMPLG
AAPTLPRLAPVLLSGPALAQPSLGNLAPFNSGPAASSGLLGLATSVLPTTTVVQTAGPGH
PLPQRPVPEQTNTSTAGTTDPVPGPLAEPLGDKVSGEQKPVAAPTTSSNDALKNLKALKT
TVPALLGGQFLPFPLPPAGGTAPPAVFGPQLQGAYFQQLYGMKKGLFPMNPVIPQTLIGL
LPNALLQAPPQPLEPTATAPPKPSELPAPGEGDAGEADELLTGSTGISTVDVTHRYLCRQ
CKMAFDGEAPAAAHQRSFCFFGRGPGGSMPPPLRVPICTYHCLACEVLLSGREALASHLR
SSAHRRKAAPPPGGPPISVTNAATAASAAVAFAKEEARLPHTDSNPKTTTTSTLLAL
NT seq 7734 nt NT seq  +upstreamnt  +downstreamnt
atggccacccttaactcagcctctaccactggcaccaccccctcccctgggcacaatgcc
ctgtccccacctccggacacctcctcctccagcacctcctctgatcctatcaccaaagat
cctcctgctgccccctccacctctgagaacatgaggtcctcagagccagggggacagccc
ctggagttgggctgtggccttgtcccaccaaaggagattgggaagccccaagaagggcct
ggctgtggtcacttctcaccaaatgacctggagatggaaaaggacaaggagcaggaggag
gatgaagggctccctcccgtggatctgagcaaccacttattcttcacagctggaggtgag
gcctacctagtggccaagctgtccctgccaggtggcagtgaactcctgttaccaaagggc
tttccctggggtgaggtgggcattaaggaagagcccagcctgcccttccttgcccatcca
cccccctcacacctcactgcccttcacatccaacatggctttgacccaatccaaggcttt
agctcttctgaccaaattctgtcccatgatacctcagcaccatctccggctgcctgtgag
ggaaggcatggagctttctggagctaccagctggctccagacccagccggagatcccaaa
gatggccctgtggggaacagcgggggcaaccacgtggcagtcttctggctctgccttttg
tgccgcctgggtttcagcaagccccaggcctttatgggtcatacacagtctcatggggtg
aagctaacccctgcccaacatcagggcctgtcaggtagcccagctgtgctccaggagggg
gatgaaggctgcaaggccctcataagctttctggaaccaaaactccctgctcgcccctct
tctgacatacaccttgacaacagcagcacagtgaacatggaggcaaatgtggccaagaca
gaggatggccctactgaggcagacgtccaggcccttgtcctcttggatgaagaagtcatg
gccctcagcccaccctctccacccacagccacctgggaccccagccaaacccaagccaaa
gaatcgccaacatcagcaggcgaggcagggccagattggttccccgaggggcaagaagag
gatggagggctctgccccccactcaaccaaagctcacccacctccaaggaggggggcact
ctccctgccccagtgggctcccccgaagaccccagtgacccaccccagccctatcgcctg
gctgatgactacaccccagcccctgcagccttccagggcctcagcctgtccagccatatg
tccctgctccactcacgcaactcctgcaagacactcaagtgtcccaagtgcaactggcac
tacaagtaccagcagaccctggatgtgcacatgcgagagaagcaccctgagagcaacagt
cactgcagctactgcagtgctgggggtgcccacccccgcctcgctcgtggagagagctac
aactgtggctacaaaccctaccggtgtgacgtctgcaactactccaccaccaccaaaggc
aacctcagtatccatatgcagtctgacaaacacctggccaacctgcagggcttccaagct
ggccctggtgggcaaggaagtccctcagagtcatcactcccaccctctgcaggagacaaa
gagcctaagaccaaatcaccctggcagtgcaaggtgtgcagctacgagacaaacatctcc
cgcaacctgcgcatccatatgacctctgagaagcacatgcagaatgtcctaatgctgcac
caggggctgccgttgggcctgccacctggactggtggggccaggccctcctcccccacca
ggggctgcccccactaacccccctgaactcttccagtactttgggccccaggccctaggg
cagcctcagactcccttgcctggcccagggctgaggccagacaagcccctggaagcccag
ctgcttctcaatggtttccatcaccttggagcacctgcccgcaagttccctacacctgca
cctggaagcctatcccctgatgcccacctgcctccaagtcagctcctgggttcctcatcc
gacagcctgcccacctcaccacccccagatgatagcctgtccctgaaggtgttccgctgc
ctagtgtgccaggccttcagcacagacagtctggagctgctgctctaccactgcagcata
ggccggagcctcccagaagctgaatggaaagaggtggctggtgacacccaccgctgcaag
ctttgctgctatggcacccagctcaaggccaacttccaactccacctcaagactgacaaa
catgctcagaagtaccagctggcagcccacctgcgggaagggggtggggctgtaggcacc
ccttccccactgcccctgggagatggggctccttatgggtccatctccccgctgcacctg
cgctgcaacatctgtgactttgagtccaacagcaaggagaagatgcagctgcatgccagg
ggtgcagcccacgaagaaaacagccaaatctataagtttctgctggaaatggagggagcg
gaggcaagggcagagctggggctataccactgtctgttgtgtgtgtgggagacaccctcc
cgcttggctatgctacaacacctgcgcacacctgcccaccgagatgcccaggcccagagg
cgtctgcagctgctacagaatggcccaactgctgaggaaggacccgaagctcttcagagc
atcctgagcttcagccacaggcagctccaaactcccgggaaggctcctgtcacccccaca
gctgagccacccatccctgagaaagatgcccagaacaagacagaacaattggcttcagaa
gagacagagaacaagactggcccttccagagacagtgccaaccagaccatggtctactgc
tgtccatactgcagcttcctgagcccagagtccagccaggtgagggctcatacactctcc
cagcatgcagtgcagcccaagtacagatgcccgctgtgccaggagcagctggtgggccgg
cctgccctgcacttccaccttagccaccttcacaatgtggtgccggagtgtgttgagaag
ctgctgcttgtagctacaaccgtagagatgacatttacaaccaaagtgctgtctggaccc
acattaagccctctggatgatggccaagaaccccccactcatgggccagagcctacaccc
agcagagaccaagcagcagaaggccctaacctgaccccagaagccagtccagattctctt
cctgagcctcccctggcctcagctgaggccccagacaaaccctcgggaagccctggtcaa
cccccttctccagccccatctccagtccctcagcctgatgcccaagttgaagatgtagct
cctctgcccaccatggctgaggaggaagaggggaccactggggagcgctctgcagagcca
gctccagctgaccctcgccatcctctgacctatcggaaaaccaccaactttgccctggac
aagtttctcgaccctgcccggccctataaatgcactgtgtgtaaggagtccttcacccag
aagaatattctgttggttcattataattctgtctcccaccttcataagatgaagaaggct
gccattgacccctccgcccctgcccggggagagactggtgccccacctaccagcactgct
gccacagacaagccctttaagtgtacagtctgccgagtctcctacaaccagagctccacc
ctggagatccacatgcggtcagttctgcatcagactcgctctcggggaaccaagactgac
tccaagattgaagggccagagcgaagccaagaagagcccaaggaaggcgagacagagggg
gagatgggcactgagaagaagggcccagaccccagtggcttcatatctggactgcctttc
ctgtcccctcccccaccgcccttggacctgcaccgattcccagcccctctcttcacccca
ccactcttgcccccattccctctggtgcccgaatcactgcttaagctccagcagcaacag
ctgctcctgcccttctacctccacgatctcaaggtggggcccaaactgacgttagctggg
cctgcacccatgctgtccctgccagctgccactcctcctcccccaccgccacctccaaag
gctgagctgactgagcaggagtgggagcggccccccatggccaaagagggtaatgaggca
gggccttcctcatcccctcaccacttgcccaacgaggctgcccgcactgcagccaagccc
ttctagaaaaactttggcttgagctgaaaaactttggctttgaagctggtgattcagtac
aatgaaggaaaacaagctgtgccccctccccctaccccacctccacctgaggccctcggg
ggtggggacaagctggcctgtggggcctgtgggaaactcttctccaatatgcttatccta
aagacacatgaggaacatgtccatcgccgctttctgccctttgaagccctgagccgttat
gctgctcagtttcgaaagagctatgacagcctatactcaccccctgcagagacccccaga
cctcctgatgggtctctggattcacctgctccccaactggccccacctttcctggtccca
gagcctgaggcagcggggacccgtgcccctgaagagcaaagccgagcagggggacgctgg
cctgcagaggaggaagaaagctccagagggaatattcctcctctgctgcctgccggccgc
cggttctccagaaccaagttcacagagttccagacccaagccctgcagtctttttttgag
actagtgcctaccccaaagacggagaggtggagcgactcgcaagtctgttgggtctggct
agccgtgtggtggtggtgtggttccagaatgcccgccagaaagcacgtaaaaatgcctgt
gagggtgggcccatgccaaccggaggaggcactgggggagcctctggctgcaggcgttgc
cacgccactttctcctgtgtttttgagttggtgcgccacctcaagaagtgctatgatgac
cagaaccctgaagaggaggaggaagaggcagagagaggggaagaggaggaagaggtggaa
gaggaagaagtagaggaggaacagagccttgaacccccagcagggcctgagggtccatta
ccagagcctccagatggggaggagctgagccaagcagaggcaacaaaggcaggaggcaaa
gaccctgaagagaagcctactccgtcaccttccccagcccacacctgtgaccagtgtgcc
atttctttctccagccaggacctcctgaccagtcaccgccgactacatttcctgccatct
gtgcagcccagtgctcccccgcaactactagatctgcccttgctggtgtttggggagaga
agccccctggtggcagccacctcaccaatgccagggccacctcttaaacggaagcttgag
gatggcagcttgtctcccacaggcagtgaagcagggggaggaggggagggcgagcccccc
agggacaagcgcctgcgcaccaccatcttacctgaacagctggagatcctgtaccgttgg
tacatgcaggattccaacccaacacgcaagatgctcgactgcatctctgaggaggtgggg
ctcaaaaagcgagtggtacaggtctggttccagaataccagagcccgggagaggaaaggc
cagtttcgaagtgcccctggaggggtgcctagtccagcagtcaagccccctgccacagct
acccctgcatctttgcccaagttcaacctcttgttgggcaaggtagatgatggcactggg
agggaggccccaaagagggaagcacctgcttttccctaccccacagccacccctgcttct
gggcccctgacttttctgccacctgggaaagaggccaccaccccaacaccagagccacct
ctccctctaccacctccccctccacccagtgaggaagagggcccagatgacccacctaaa
gcttctccagagagtgaggcttgcagtctgtctgcaggagatctgagtgattcgtctgct
tccagcctggctgaaccagaatcccctggggctggagggaccagtgggggacctggaggt
gggactggggttccagatggaatggggcagcggcgctacaggacccagatgagcagcttg
cagctgaagatcatgaaagcctgctatgaagcttaccgtacccccaccatgcaggagtgt
gaggtgctgggggaggagattgggctgcccaagagagtcatccaggtctggttccagaac
gctcgtgccaaggaaaagaaggccaaactacagggggcagccactgggagcaatggggtc
agcagtgagggccccttggcagcccagcgcaccgactgcccctactgtgatgtcaagtat
gatttctatgtctcctgccgaggccatctcttttcccgtcagcacctggccaagctcaag
gaggcagtccgagcccagctgaagagtgaaagcaagtgctacgacttggccccggcacct
gaggctcccccagctcccaaggccccacccgccaccacacctgcttccatgcccctcggg
gctgccccaaccttgcctcgcctggccccggttctcttgtctggtccagctctggctcaa
ccctcgctgggcaacttagctcctttcaattcaggcccggcagcctcctcaggcctcctt
ggcctcgccacttcggtcctgcctaccaccacagtagtccagactgctggcccaggccac
cccttacctcagagacctgtgcctgagcaaaccaacacctccacagcaggcaccactgac
ccggtccccggccctcttgctgagcccttgggggacaaggtctccggtgagcaaaagcca
gttgcagcccccaccacctcctccaatgatgccctcaagaacctcaaagcattgaagacc
actgtcccagccctattggggggccagttcctgccctttccattgccccctgcagggggg
acagcaccgccagctgtctttggcccccagctacaaggagcctacttccaacagctctat
ggcatgaagaaggggctatttcccatgaaccctgtgatacctcagaccctcattgggctg
ctccccaatgccctcctccaggcaccaccccagccccttgagcccacagccacagcacct
ccaaagccttctgaattgcctgctccaggggagggggacgctggtgaggctgacgagctg
ctgacaggcagcactggcatctccaccgtggatgtaacccatcgctacctgtgccgccag
tgcaagatggcatttgacggggaggccccggctgctgcccaccagagatccttctgcttc
tttgggcggggccctgggggctccatgccacccccattgcgggtgcccatctgcacctac
cactgcctggcatgtgaggtgctgctgagtgggcgtgaagccctggcctcccacctgcgc
tcctcggcccataggcgcaaggcagccccgcctccagggggcccacccatctctgtcacc
aacgccgccactgctgcctcggctgctgtggcatttgccaaagaggaagcaagattacct
cacacggactccaacccaaaaactactactacctctacacttctagctttataa

DBGET integrated database retrieval system