KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391893
Entry
100391893         CDS       T03264                                 

Gene name
NRG2
Definition
(RefSeq) neuregulin 2
  KO
K05456  neuregulin 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc04012  ErbB signaling pathway
cjc05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100391893 (NRG2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100391893 (NRG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100391893 (NRG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100391893 (NRG2)
Cytokines and growth factors [BR:cjc04052]
 Growth factors
  Growth factors (RTK binding)
   100391893 (NRG2)
SSDB
Motif
Pfam: Neuregulin I-set Ig_3 ig Ig_2 EGF C2-set_2 V-set Ig_6 DUF3169
Other DBs
NCBI-GeneID: 100391893
NCBI-ProteinID: XP_017823631
Ensembl: ENSCJAG00000016833
LinkDB
Position
2
AA seq 839 aa
MRQVCCSALPPPPLEKARCSSYSDSSSSSERSSSSSESGSSSRSSSNNSISRPAAPLEPR
PQQQPQPRSPAARRAAARSRAAAAGGMRRDPAPGFSMLLFGVSLACYSPSLKSVQDQAYK
TPVVVEGKVQGLAPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCA
PLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMKSQT
GQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKVEDA
GEYVCEAENILGKDTVRGRLYVNSVSTTLASWSGHARKCNETAKSYCVNGGVCYYIEGIN
QISCKCPVGYTGDRCQQFAMVNFSKHLGFELKEAEELYQKRVLTITGICVALLVVGIVCV
VAYCKTKKQRKQMHNHLRQNMCPAHQNRSLANGPSHPRLDPEEIQMADYISKNVPATDHV
IRRETETTFSGSHSCSPSHHCSTATPTSSHRHESHTWSLERSESLTSDSQSGIMLSSVGT
SKCNSPACVEARARRAAAYNLEERRRATAPAYHDSVDSLRDSPHSERYVSALTTPARLSP
VDFHYSLATQVPTFEITSPNSAHAVSLPPAAPISYRLTEQQPKVRHPAPPGPGPGPXTGA
DMQRSYDSYYYPXGRPGPRRGTCALGGSLGSLPASPFRIPEDDEYETTQECAPPPPPRPR
GRGASRRTSAGPRRWRRSRLNGLAAQRARAARDSLSLSSGSGGGSASASDDDADGALAAE
STPFLGLRAEHDSLRSDSPPLCPAADSRTYYSLDSHSTRASSRHSRGPPPRAKQDSAPL
NT seq 2520 nt   +upstreamnt  +downstreamnt
atgcggcaggtttgctgctcagcgctgccgccgccgccactggagaaggctcggtgcagc
agctacagcgacagcagcagcagcagcgagaggagcagcagcagcagcgagagcggcagc
agcagcaggagcagcagcaacaacagcatctcccgtcccgctgcgcccctagagccgcgg
ccgcagcaacagccgcagccccgcagccccgcagcccggagagccgccgcccgttcgcga
gccgcagccgccggcggcatgaggcgcgacccggcccccggcttctccatgctcctcttc
ggtgtgtcgctcgcctgctactcgcccagcctcaagtcggtgcaggaccaggcgtacaag
acacccgtggtggtggagggcaaggtacaggggctagccccagccggcggctccagctcc
aacagcacccgagagccgcccgcctcgggtcgggtggcgctggtgaaggtgctggacaag
tggccgctccggagcggggggctgcagcgcgagcaggtgatcagcgtgggctcttgtgcg
ccgctcgaaaggaaccagcgctacatctttttcctggagcccacggaacagcccttagtc
tttaagacggcctttgcccccctcgacaccaacggcaaaaatctcaagaaagaggtgggc
aagatcctgtgcactgattgcgccacccggcccaagctgaagaagatgaagagccagacg
ggacaggtgggtgagaagcaatcgctgaagtgtgaggcagcagctggtaatccccaacct
tcctaccgttggttcaaggacggcaaagagctcaaccgcagccgagacattcgcatcaaa
tatggcaacggcagaaagaactcacgactacagttcaacaaggtgaaggtggaggacgct
ggggagtatgtctgcgaggccgagaacatcctggggaaggacaccgtccggggccggctt
tacgtcaacagcgtgagcaccaccctggcatcctggtcggggcacgcccggaagtgcaac
gagacagccaagtcctattgtgtcaatggaggtgtctgctactacatcgagggcatcaac
cagatctcctgcaagtgtcctgtgggatacaccggggacaggtgtcagcagttcgcaatg
gtcaacttctccaagcaccttggatttgaattaaaggaagccgaggagctgtaccagaag
agggtcctgaccatcacgggcatctgcgtggctctgctggtcgtgggcatcgtctgtgtt
gtggcctactgcaagaccaaaaaacagaggaagcagatgcataaccacctccggcagaac
atgtgcccggcccaccagaaccggagcttggccaatgggcccagccacccacggctggac
ccagaggagatccaaatggcagattatatctccaagaacgtgccagccacagaccacgtc
atcaggagagaaactgagaccaccttctctgggagccactcctgttcaccttctcaccac
tgctccacagccacacccacctccagccacagacacgagagccacacgtggagcctggaa
cgttctgagagcctgacctctgactcgcagtcaggcatcatgctgtcatcagtgggtacc
agcaaatgcaacagcccagcgtgtgtggaggctcgggcaaggcgggcagcagcctacaac
ctggaggagcggcgcagggccaccgcaccagcctaccatgactctgtggactccctgcgt
gactccccacacagcgagaggtatgtatcggccctgaccacgcccgcgcgcctctcgccc
gtggacttccactactcgctggccacgcaggtgccgactttcgagatcacgtcccccaac
tcagcgcacgctgtgtcgctgccgccggccgcgcccatcagctaccgcctgacggagcag
cagccaaaagtgcggcacccggcgccccccggcccggggcccggaccnnggaccggcgcg
gacatgcagcgcagctacgacagctactactacccgnncggcagacccgggccgcggcgc
gggacctgcgcgctcggcggcagcctgggcagcctgcccgccagcccctttcgcatcccg
gaggacgacgagtacgagaccacgcaggagtgcgcgcccccgccgccaccgcggccgcgc
gggcgcggcgcgtcccgcaggacgtcggcggggccccggcgctggcgccgctcgcgcctc
aacgggctggcggcgcagcgcgcacgggcggcgcgggactcgctgtcgctgagcagcggc
tcgggcggcggctcggcctcggcgtcggacgacgacgcggacggagcgctggctgccgag
agcacgcctttcctgggcctgcgcgcggagcacgactcgctgcgctcggactcgccgccg
ctgtgcccggcggccgacagcaggacttactactccctggacagccacagcacgcgggcc
agcagcagacacagccgcgggccgcccccgcgggccaagcaggactcggcgccactctag

DBGET integrated database retrieval system