KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391925Help
Entry
100391925         CDS       T03264                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase 1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04146  Peroxisome
cjc04213  Longevity regulating pathway - multiple species
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05016  Huntington disease
cjc05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100391925 (SOD1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100391925 (SOD1)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100391925 (SOD1)
   05016 Huntington disease
    100391925 (SOD1)
   05020 Prion diseases
    100391925 (SOD1)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100391925 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 100391925
NCBI-ProteinID: XP_002761406
Ensembl: ENSCJAG00000008983
UniProt: F6XEH9
LinkDB All DBs
Position
21
AA seq 154 aa AA seqDB search
MAMKAVCVLKGDGPVQGTINFEQKESNGPVKVWGSITGLAEGLHGFHVHQFGDNTQGCTS
AGPHFNPLSRKHGGPEDEERHVGDLGNVTAGKDGVASVSIEDSVISLSGVHSIIGRTLVV
HEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaaggcggtgtgcgtgttgaagggcgacggcccggtgcagggcaccatcaat
ttcgagcagaaggaaagtaatggaccagttaaggtgtggggaagcattacaggattggct
gaaggcctgcatggattccatgttcatcagtttggagacaacacacaaggctgtaccagt
gcaggtcctcactttaatcctctatccagaaaacatggtgggccagaggatgaagagagg
catgttggagacctgggcaatgtgactgctggtaaagatggtgtggccagtgtgtcaatt
gaagattctgtgatctcactctcaggagtccattccatcattggccgcacgttggtggtc
catgaaaaagcagatgacttgggcaaaggtggaaatgaagaaagtacaaagacaggaaac
gctggaagtcgtttggcttgtggtgtcattgggatcgcccagtaa

DBGET integrated database retrieval system