KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392014
Entry
100392014         CDS       T03264                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04390  Hippo signaling pathway
cjc04810  Regulation of actin cytoskeleton
cjc05200  Pathways in cancer
cjc05218  Melanoma
cjc05224  Breast cancer
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100392014 (FGF1)
   04014 Ras signaling pathway
    100392014 (FGF1)
   04015 Rap1 signaling pathway
    100392014 (FGF1)
   04390 Hippo signaling pathway
    100392014 (FGF1)
   04151 PI3K-Akt signaling pathway
    100392014 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100392014 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100392014 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100392014 (FGF1)
   05218 Melanoma
    100392014 (FGF1)
   05224 Breast cancer
    100392014 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100392014 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100392014 (FGF1)
Cytokines and growth factors [BR:cjc04052]
 Growth factors
  Growth factors (RTK binding)
   100392014 (FGF1)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100392014 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100392014
NCBI-ProteinID: XP_002744341
Ensembl: ENSCJAG00000018301
UniProt: B0KW92
LinkDB
Position
2
AA seq 155 aa
MAEGEITTFTALTEKFDLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcaccaccttcacagccctgaccgagaagtttgatctgcctcca
gggaattacaagaagcccaaactcctctactgtagcaatgggggccacttcttgaggatc
cttccggatggcacagtggatgggacaagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttg
gccatggacaccgacgggcttttatacggctcacagacaccaaatgaggaatgtttgttc
ctggagaggctggaggagaaccattacaacacctatatatccaagaaacatgcagagaag
aattggtttgtcggcctcaagaagaatggaagctgtaaacgtggtcctcggactcactat
ggtcagaaagcgatcttgtttctccccctgccagtttcttctgattaa

DBGET integrated database retrieval system