KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392174
Entry
100392174         CDS       T03264                                 

Gene name
ATP1B2
Definition
(RefSeq) ATPase Na+/K+ transporting subunit beta 2
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04260  Cardiac muscle contraction
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04911  Insulin secretion
cjc04918  Thyroid hormone synthesis
cjc04919  Thyroid hormone signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04960  Aldosterone-regulated sodium reabsorption
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04964  Proximal tubule bicarbonate reclamation
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc04973  Carbohydrate digestion and absorption
cjc04974  Protein digestion and absorption
cjc04976  Bile secretion
cjc04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100392174 (ATP1B2)
   04022 cGMP-PKG signaling pathway
    100392174 (ATP1B2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100392174 (ATP1B2)
   04918 Thyroid hormone synthesis
    100392174 (ATP1B2)
   04919 Thyroid hormone signaling pathway
    100392174 (ATP1B2)
   04925 Aldosterone synthesis and secretion
    100392174 (ATP1B2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100392174 (ATP1B2)
   04261 Adrenergic signaling in cardiomyocytes
    100392174 (ATP1B2)
  09154 Digestive system
   04970 Salivary secretion
    100392174 (ATP1B2)
   04971 Gastric acid secretion
    100392174 (ATP1B2)
   04972 Pancreatic secretion
    100392174 (ATP1B2)
   04976 Bile secretion
    100392174 (ATP1B2)
   04973 Carbohydrate digestion and absorption
    100392174 (ATP1B2)
   04974 Protein digestion and absorption
    100392174 (ATP1B2)
   04978 Mineral absorption
    100392174 (ATP1B2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100392174 (ATP1B2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100392174 (ATP1B2)
   04964 Proximal tubule bicarbonate reclamation
    100392174 (ATP1B2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cjc04090]
    100392174 (ATP1B2)
CD molecules [BR:cjc04090]
 Proteins
  100392174 (ATP1B2)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 100392174
NCBI-ProteinID: XP_017827819
Ensembl: ENSCJAG00000015019
UniProt: U3BNL0
LinkDB
Position
5
AA seq 290 aa
MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFSLTMW
VMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDS
IQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGICSGIGDPTHYGYSTGQPCVFI
KMNRVINFYAGANQSMNVTCAGKRDEDAENLGHFVMFPSNGNIDLMYFPYYGKKFHVNYT
QPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT
NT seq 873 nt   +upstreamnt  +downstreamnt
atggtcatccagaaagagaagaagagctgcgggcaggtggttgaggagtggaaggagttc
gtgtggaacccgaggacgcaccagttcatgggccgcaccgggaccagctgggcctttatc
ctcctcttctacctcgtcttttatggcttcctcaccgccatgttctctctcaccatgtgg
gtgatgctacagactgtctccgaccatacccccaagtaccaggaccgactggccacacca
ggcttgatgattcgccccaagactgagaaccttgatgtcattgtcaatgtcagtgacact
gaaagctgggaccagcatgttcagaagctcaacaagttcttggagccttacaacgactct
atccaagcccagaagaatgatgtctgccgccctgggcgctattacgaacagccagataat
ggagtcctcaactaccccaaacgtgcctgccaattcaaccggacccagctgggcatctgc
tccggcattggggaccccacccactatggttacagcactgggcagccctgtgtcttcatc
aagatgaaccgggtcatcaacttctatgcaggagcaaaccagagcatgaatgttacctgt
gctgggaagcgagatgaagatgctgagaatctcggccatttcgtcatgttcccttccaat
ggcaacatcgacctcatgtacttcccctactatggcaaaaagttccacgtaaactacaca
cagcccctggtggccgtgaagttcctgaatgtgacccccaatgtggaggtgaatgtagaa
tgccgcatcaatgccgccaacatcgccacagacgatgagcgagacaagtttgctggccgc
gtggcattcaaactccgcatcaacaaaacctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393318
Entry
100393318         CDS       T03264                                 

Gene name
ATP1A1
Definition
(RefSeq) ATPase Na+/K+ transporting subunit alpha 1
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04260  Cardiac muscle contraction
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04911  Insulin secretion
cjc04918  Thyroid hormone synthesis
cjc04919  Thyroid hormone signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04960  Aldosterone-regulated sodium reabsorption
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04964  Proximal tubule bicarbonate reclamation
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc04973  Carbohydrate digestion and absorption
cjc04974  Protein digestion and absorption
cjc04976  Bile secretion
cjc04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100393318 (ATP1A1)
   04022 cGMP-PKG signaling pathway
    100393318 (ATP1A1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100393318 (ATP1A1)
   04918 Thyroid hormone synthesis
    100393318 (ATP1A1)
   04919 Thyroid hormone signaling pathway
    100393318 (ATP1A1)
   04925 Aldosterone synthesis and secretion
    100393318 (ATP1A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100393318 (ATP1A1)
   04261 Adrenergic signaling in cardiomyocytes
    100393318 (ATP1A1)
  09154 Digestive system
   04970 Salivary secretion
    100393318 (ATP1A1)
   04971 Gastric acid secretion
    100393318 (ATP1A1)
   04972 Pancreatic secretion
    100393318 (ATP1A1)
   04976 Bile secretion
    100393318 (ATP1A1)
   04973 Carbohydrate digestion and absorption
    100393318 (ATP1A1)
   04974 Protein digestion and absorption
    100393318 (ATP1A1)
   04978 Mineral absorption
    100393318 (ATP1A1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100393318 (ATP1A1)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100393318 (ATP1A1)
   04964 Proximal tubule bicarbonate reclamation
    100393318 (ATP1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100393318 (ATP1A1)
Enzymes [BR:cjc01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     100393318 (ATP1A1)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100393318 (ATP1A1)
  Exosomal proteins of other body fluids (saliva and urine)
   100393318 (ATP1A1)
  Exosomal proteins of colorectal cancer cells
   100393318 (ATP1A1)
  Exosomal proteins of bladder cancer cells
   100393318 (ATP1A1)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 100393318
NCBI-ProteinID: XP_002751328
Ensembl: ENSCJAG00000006058
UniProt: F6Q7A8
LinkDB
Position
7
AA seq 1023 aa
MGKGVGRDKYEPAAVSEQGDKKGKKVKKERDMDELKKEVSMDDHKLSLDELHRKYGTDLS
RGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGFSMLLWIGAILCFLAYSIQAA
TEEEPQNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSI
NAEEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETR
NIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAAEIEHFIHIITGVAV
FLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKN
LEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWLA
LSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIELCCGSVKEMRERYAKIVEI
PFNSTNKYQLSIHKNPNTSEPRHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQN
AYLELGGLGERVLGFCHLFLPDEQFPEGFQFDTDDVNFPVDNLCFVGLISMIDPPRAAVP
DAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVNQVNPRDA
KACVVHGSDLKDMTSEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVN
DSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTL
TSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPK
TDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPLHLLGLRVDWDDRWINDVED
SYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFE
ETALAAFLSYCPGMGVALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKE
TYY
NT seq 3072 nt   +upstreamnt  +downstreamnt
atggggaagggggttggacgtgataaatatgaacctgcagctgtttcggaacaaggtgat
aagaagggcaaaaaggtcaaaaaagaaagggacatggatgaactgaagaaagaagtttct
atggatgatcataaacttagccttgatgaacttcatcgtaaatatggaacagacttgagc
cggggcttaacatctgctcgagcagctgagatcctggcgcgagatggtcccaacgccctc
actccccctcccactactcctgaatggatcaaattttgtcggcagctctttggggggttc
tcaatgttactgtggattggagcaattctttgtttcttggcttatagcatccaagctgct
acagaagaggaacctcaaaacgataatctgtacctgggtgtggtgctatcagccgttgtc
attataactggttgcttctcctactatcaggaagctaaaagttcaaagatcatggaatcc
ttcaaaaacatggtccctcagcaagcccttgtgattcgaaatggtgagaaaatgagcata
aatgccgaggaggttgtggttggggatctggtagaagtgaaaggaggagaccgaattcct
gctgacctcagaatcatatctgcaaatggctgcaaggtggataactcctcactcactggt
gaatcagaaccccagacgaggtctccagatttcacaaatgaaaaccccctggagactagg
aacattgccttcttttcaaccaattgtgttgaaggcaccgcacgtggtattgttgtctac
actggggatcgcactgtgatgggaagaattgccacacttgcttctgggctcgaaggaggc
cagacccccattgctgcagaaattgaacattttatccacatcatcacgggtgtggctgtg
ttcctgggtgtgtctttcttcattctttctctcatccttgagtacacctggcttgaggct
gtcatcttcctcatcggtatcatcgtagccaatgtgccagaaggtttgctggccactgtc
acggtctgtctgacacttactgccaaacgcatggcgaggaagaactgcttagtgaagaac
ttagaagctgtggagaccttggggtccacatccaccatctgctcggataaaactggaact
ctgactcagaaccggatgacagtggcccacatgtggtttgacaatcaaatccatgaagct
gatacgacagagaatcagagtggtgtctcttttgacaagacttcagctacctggcttgct
ctgtccagaattgcaggtctttgtaacagggcagtgtttcaggctaaccaggaaaaccta
cctattcttaagcgggcagttgcgggagatgcttctgagtcagcgctcttaaaatgcatc
gagctgtgctgtggttctgtgaaggagatgagagaaagatacgccaaaatcgtcgagata
cccttcaactccaccaacaagtaccagttgtccattcataagaaccccaacacctcggag
ccccgacacctgttggtgatgaagggtgccccagaaaggatcctagaccgttgcagctct
atcctcctccatggcaaggagcagccccttgatgaggagctgaaagatgcctttcagaat
gcctacttggagctggggggcctcggagaacgagtcttaggtttctgccacctcttcctg
ccagatgagcagtttcctgaagggttccagtttgacaccgacgatgtgaatttccctgtc
gacaatctgtgctttgtggggctcatctccatgatcgaccctccgcgggcggccgttccc
gatgccgtgggcaaatgtcggagcgctgggatcaaggtcatcatggtcacaggagaccat
cccatcacagctaaagctattgccaaaggtgtgggcatcatctcagaaggcaatgagact
gtagaagacattgctgcccgcctcaacatcccagtcaaccaggtgaaccccagggatgcc
aaggcctgtgtagtacatggcagtgatctaaaggacatgacctccgagcagctggatgac
attttgaagtaccatactgagattgtgttcgccaggacctcccctcagcagaagctcatc
attgtggaaggctgccagagacagggcgctatcgtggctgtgacaggtgacggtgtgaat
gactctccagctttgaagaaagcagacattggggttgccatggggattgctggctcagat
gtgtccaagcaagctgctgacatgattcttttggatgacaactttgcctcaattgtgact
ggagtagaggaaggtcgtctgatctttgataacttaaagaaatccattgcttatacctta
accagtaacattcccgagatcacccccttcctgatatttattatcgcaaacattccacta
ccactggggaccgtcaccatcctctgcattgacttgggcactgacatggttcctgccatc
tccctggcttatgagcaggctgagagtgacatcatgaagagacagcccagaaatcccaaa
acagacaaacttgtgaatgagcggctgatcagcatggcctatgggcagattggtatgatc
caggccctgggtggcttctttacttactttgtgattctggctgagaatggcttcctcccg
cttcacctgttgggcctccgagtggactgggatgaccgctggatcaacgatgtggaagac
agctacggacagcagtggacctatgagcagaggaaaatcgtggagttcacttgccacaca
gccttcttcgtcagtatcgtggtggtgcagtgggctgacttggtcatctgtaagaccagg
aggaattcagtcttccagcaggggatgaagaacaagatcttgatatttggcctctttgaa
gagactgccctggctgctttcctttcctactgccctggaatgggtgttgcgcttcggatg
tatcccctcaaacctacctggtggttctgtgccttcccctactctcttctcatctttgta
tatgacgaagtcagaaaactcatcatcaggcgacgccctggcggctgggtggagaaggaa
acctactactag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402438
Entry
100402438         CDS       T03264                                 

Gene name
ATP1A2
Definition
(RefSeq) ATPase Na+/K+ transporting subunit alpha 2
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04260  Cardiac muscle contraction
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04911  Insulin secretion
cjc04918  Thyroid hormone synthesis
cjc04919  Thyroid hormone signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04960  Aldosterone-regulated sodium reabsorption
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04964  Proximal tubule bicarbonate reclamation
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc04973  Carbohydrate digestion and absorption
cjc04974  Protein digestion and absorption
cjc04976  Bile secretion
cjc04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100402438 (ATP1A2)
   04022 cGMP-PKG signaling pathway
    100402438 (ATP1A2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100402438 (ATP1A2)
   04918 Thyroid hormone synthesis
    100402438 (ATP1A2)
   04919 Thyroid hormone signaling pathway
    100402438 (ATP1A2)
   04925 Aldosterone synthesis and secretion
    100402438 (ATP1A2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100402438 (ATP1A2)
   04261 Adrenergic signaling in cardiomyocytes
    100402438 (ATP1A2)
  09154 Digestive system
   04970 Salivary secretion
    100402438 (ATP1A2)
   04971 Gastric acid secretion
    100402438 (ATP1A2)
   04972 Pancreatic secretion
    100402438 (ATP1A2)
   04976 Bile secretion
    100402438 (ATP1A2)
   04973 Carbohydrate digestion and absorption
    100402438 (ATP1A2)
   04974 Protein digestion and absorption
    100402438 (ATP1A2)
   04978 Mineral absorption
    100402438 (ATP1A2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100402438 (ATP1A2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100402438 (ATP1A2)
   04964 Proximal tubule bicarbonate reclamation
    100402438 (ATP1A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100402438 (ATP1A2)
Enzymes [BR:cjc01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     100402438 (ATP1A2)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100402438 (ATP1A2)
  Exosomal proteins of other body fluids (saliva and urine)
   100402438 (ATP1A2)
  Exosomal proteins of colorectal cancer cells
   100402438 (ATP1A2)
  Exosomal proteins of bladder cancer cells
   100402438 (ATP1A2)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 Sigma70_r4
Other DBs
NCBI-GeneID: 100402438
NCBI-ProteinID: XP_017821884
LinkDB
Position
18
AA seq 1020 aa
MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKG
LTNQRAQDILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAAME
DEPSNDNLYLGVVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVIREGEKMQINA
EEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNI
CFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGRTPIAMEIEHFIQLITGVAVFL
GVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALS
RIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVAEIPF
NSTNKYQLSIHEREDSPQSHVLVMKGAPERILDRCSTILVQGKEIPLDKEMQDAFQNAYM
ELGGLGERVLGFCQLNLPSGKFPRGFKFDTDELNFPTEKLCFVGLMSMIDPPRAAVPDAV
GKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPREAKAC
VVHGSDLKDMTSEQLDEILKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSP
ALKKADIGIAMGISGSDVSKQASDMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSN
IPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNSQTDK
LVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRTMNDLEDSYG
QEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETA
LAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFIYDEVRKLILRRYPGGWVEKETYY
NT seq 3063 nt   +upstreamnt  +downstreamnt
atgggccgtggggccggccgtgagtactcgcctgccgccaccacggcagagaatgggggc
ggcaagaagaaacagaaagagaaggaactggatgagctgaagaaggaggtggcaatggat
gaccacaagctgtccttggatgagctgggccgaaaataccaagtggacctgtccaagggc
ctcaccaaccagcgggctcaggacattctggctcgagatgggcccaatgccctcacacca
cctcccacaacccctgagtgggtcaagttctgccgtcagctctttggggggttctccatc
ctgctgtggattggggccatcctctgcttcctggcctacggcatccaggctgccatggaa
gatgaaccatccaacgacaatctgtatctgggtgtggtgctggcagctgtggtcattgtc
actggctgcttctcctactaccaggaggccaaaagctccaagatcatggattccttcaag
aacatggtacctcagcaagcccttgtgatccgggagggagagaagatgcagatcaatgca
gaggaagtggtggtgggagacctggtggaggtgaagggtggagaccgagtccctgctgac
ctccgaattatctcttctcatggctgtaaggtggataactcatccctaacaggagagtcg
gagccccagacccgctcccctgagttcacccacgagaaccccctggagacccgcaatatc
tgtttcttctccaccaactgtgttgaaggcacggctaggggcatcgtgattgccacaggt
gaccggacggtgatgggccgcatagccacgctcgcctcaggcctagaggttgggcggacg
cccatagccatggagattgaacacttcatccagctgatcacaggggttgctgttttcctg
ggggtctccttcttcgtgctctccctcatcctgggctacagctggctggaggcagtcatc
tttctcatcggcatcatcgtggccaacgtgcctgaggggcttctggccactgtcactgtg
tgcctgaccctgaccgccaagcgcatggcacggaagaactgcctagtgaagaacctggag
gcggtggagacgctgggctccacgtccaccatctgctcggacaagacgggcaccctcacc
cagaaccgcatgaccgttgcccacatgtggttcgacaaccaaatccatgaggctgacacc
accgaagaccagtctggggccacttttgacaaacgatcccccacgtggacggccctgtcc
cgaattgctggtctctgcaaccgtgctgtcttcaaggcaggacaggagaacatctctgtg
tctaagcgggacacagctggtgacgcctccgagtcagctctactcaagtgcattgagctg
tcctgtggttcagtgagaaagatgagagacagaaaccccaaggtggcagagattcctttc
aactcgaccaacaagtaccagctgtccatccatgagcgagaagacagcccccagagccac
gtgctggtgatgaagggggccccagagcgcatcctggaccggtgctccaccatcctggtg
cagggcaaggagatcccgcttgacaaggagatgcaagacgcctttcaaaatgcctacatg
gagctggggggactgggagagcgtgtgctggggttctgtcaactgaatctgccctctggt
aagtttcctcggggcttcaaattcgacacggatgagctgaactttcccacggagaagctc
tgctttgtggggctcatgtctatgatcgaccctccccgggctgctgtgccagatgctgtg
ggcaagtgccgaagcgcaggcatcaaggtgatcatggtaaccggggatcaccctatcaca
gccaaggccattgccaaaggcgtgggcatcatatcagaggggaatgagactgtggaggac
attgcggcccggctcaacattcccgtgagtcaagtcaaccccagggaagccaaggcatgt
gtggtgcacggctctgacctgaaggacatgacatcggagcagctcgatgagatccttaag
aaccacacggagattgtctttgctcgaacgtctccccagcagaagctcattattgtggag
ggatgtcagaggcagggagccattgtggccgtgacgggtgacggggtgaatgactcccct
gcgctgaagaaggctgacattggcattgccatgggcatctctggctctgacgtctctaag
caggcatccgacatgatcctgctggacgacaactttgcctccatcgtcacgggggtggag
gagggccgcctgatctttgacaacctgaagaaatccatcgcctacaccctgaccagcaac
atccctgagatcacccccttcctgctcttcatcattgccaacatccccctacctctgggc
accgtgaccatcctctgcattgacctgggcacagatatggtccctgccatctccttggcc
tatgaggcagctgagagtgacatcatgaagcggcagcctcgaaactctcagacagacaag
ctagtgaatgagaggctcatcagcatggcatatggacagatcgggatgattcaggcactg
ggtggcttcttcacctactttgtgatcctggcagagaatggtttcctgccatcacggctg
ctgggaatccgcctcgactgggatgaccggaccatgaacgacctggaagacagctatgga
caggagtggacctatgagcagcggaaggtggtggagttcacttgccacacggcattcttt
gccagcatcgtggtggtgcagtgggctgaccttatcatctgcaagacccgtcgcaactca
gtcttccagcagggcatgaagaacaagatcctgatttttgggctcctggaggagacggca
ttggctgcctttctctcttactgcccgggtatgggtgtggccctccgcatgtacccactc
aaggtcacctggtggttctgtgccttcccctacagcctcctcatcttcatctatgatgag
gtccgaaagctcatcctgcggcgatatcctggtggctgggtggagaaggagacatactac
tga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403160
Entry
100403160         CDS       T03264                                 

Gene name
ATP1A4
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-4
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04260  Cardiac muscle contraction
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04911  Insulin secretion
cjc04918  Thyroid hormone synthesis
cjc04919  Thyroid hormone signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04960  Aldosterone-regulated sodium reabsorption
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04964  Proximal tubule bicarbonate reclamation
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc04973  Carbohydrate digestion and absorption
cjc04974  Protein digestion and absorption
cjc04976  Bile secretion
cjc04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100403160 (ATP1A4)
   04022 cGMP-PKG signaling pathway
    100403160 (ATP1A4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100403160 (ATP1A4)
   04918 Thyroid hormone synthesis
    100403160 (ATP1A4)
   04919 Thyroid hormone signaling pathway
    100403160 (ATP1A4)
   04925 Aldosterone synthesis and secretion
    100403160 (ATP1A4)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100403160 (ATP1A4)
   04261 Adrenergic signaling in cardiomyocytes
    100403160 (ATP1A4)
  09154 Digestive system
   04970 Salivary secretion
    100403160 (ATP1A4)
   04971 Gastric acid secretion
    100403160 (ATP1A4)
   04972 Pancreatic secretion
    100403160 (ATP1A4)
   04976 Bile secretion
    100403160 (ATP1A4)
   04973 Carbohydrate digestion and absorption
    100403160 (ATP1A4)
   04974 Protein digestion and absorption
    100403160 (ATP1A4)
   04978 Mineral absorption
    100403160 (ATP1A4)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100403160 (ATP1A4)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100403160 (ATP1A4)
   04964 Proximal tubule bicarbonate reclamation
    100403160 (ATP1A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100403160 (ATP1A4)
Enzymes [BR:cjc01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     100403160 (ATP1A4)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100403160 (ATP1A4)
  Exosomal proteins of other body fluids (saliva and urine)
   100403160 (ATP1A4)
  Exosomal proteins of colorectal cancer cells
   100403160 (ATP1A4)
  Exosomal proteins of bladder cancer cells
   100403160 (ATP1A4)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 HAD
Other DBs
NCBI-GeneID: 100403160
NCBI-ProteinID: XP_008982958
LinkDB
Position
18
AA seq 1028 aa
MELGWKKRAVAPMEQNPRQIPIKGPKPSKKKMKRQKKERDTEELKKEMVMDDHKLTLEEL
STKYSVNLTTGHSHQRAKEILIRDGPNTLTPPPTTPEWVKFCKQLFGGFSLLLWTGAILC
SXXXXRGVQDEPRSDSLYLSIVLAVVVVITGCFSYYQEAKSSKIMESFKNMVPQQALVIR
EGEKMQINVQDVVLGDLVEIKGGDRIPADLRLISARGCKVDNSSLTGESEPQSRCTDFTH
ENPLETRNICFFSTNCVEGTARGVVIATGDSTVMGRIASLTSGLESGQTPIAAEIEHFIR
LITVVAVFLGVTFFVLSLLLGYGWLEAIIFLIGIIVANVPEGLLATVTVCLTLTAKRMAR
KNCLVKNLEAVETLGSTSVICSDKTGTLTQNRMIVAHMWFDETTYEVDTSKEQTGKTFAN
NSDTWFTLAQIAGLCNRADFKPHQETLPIAKRATTGDASESALLKFIEQSFSSVTEMRKK
NPKVAEIPFNSTNKYQMSIHFREDSSQTHVLMMKGAPERILEFCSTFLLHGQEYSMDDEL
KEAFQNACLELGGLGERVLGFCFLNLPSSFSKGFPFNTDEINFPMDNLCFVGLISMIDPP
RTTVPEAVNMCRSAGIKVIMVTGDHPITAKAIAQRVGIISENTETAEEVAARLRIPVSKV
NPSDAKAIVVHGSELKDLHSEQLDQILRNHTEIVFARTSPQQKLIIVEGCQRLGVIVAVT
GDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKS
IMYTLTSNIPEITPFLLFIVLGIPLPLGTITILCIDLGTDMVPAISLAYESAESDIMKRR
PRNPKMDKLVNHRLIAMAYGQIGMIQAVAGFFTYFVIMAENGFRPMDLLGIRLYWEDKFL
NDLEDSYGQQWTYEQRKVVEFTCQTAFFVTIVLVQWADLIVSKTRRNSVFQQGMRNKILI
FGILEETFLAAFLSYTPGMDVALRMYPLKISWWFCAIPYSILIFVYDEIRKLLIRQRPGG
WVERETYY
NT seq 3087 nt   +upstreamnt  +downstreamnt
atggagctggggtggaagaaacgggcagtggctcccatggagcagaatccaagacaaata
cctataaaggggcctaaacctagcaagaaaaaaatgaagaggcaaaaaaaggagagagat
acagaggaactgaagaaggaaatggttatggacgatcacaaattaaccttggaagagctg
agcaccaagtactccgtgaaccttacaacgggccatagccaccaaagggcaaaggaaatc
ctgattcgagatggacccaatacccttaccccaccccctaccactccggaatgggtcaaa
ttctgtaagcaactgttcggtggcttttccctcctactgtggactggggccattctctgc
tctnnnnnnnnnngtagaggagttcaagatgagcctagatctgattctctctacctgagc
atcgtactcgctgtggtggttgtcatcaccggctgcttctcctattatcaggaggccaag
agctccaagatcatggagtcttttaagaacatggtgcctcagcaagctctggtaattcga
gaaggagagaagatgcaaattaatgtacaagatgtggtgttgggagatctagtggaaatc
aagggtggagaccgaatccccgctgacctccggcttatctctgcacgtggatgtaaggtg
gacaactcgtccttgactggggagtcagaaccccagtcccgctgtactgacttcacccat
gagaaccctctggagacccgaaacatctgcttcttttctaccaactgtgtggaaggaacc
gcccgaggtgtcgtgattgctaccggagactccacagtgatgggcagaatcgcctccctg
acatcaggcctggagtctggccagacacccatcgccgctgagatcgaacacttcatccgt
ctgatcactgtggtggctgtcttccttggtgtcactttttttgtgctctcacttctcttg
ggctatggctggctggaggctatcatttttctcattggcatcattgtggccaatgtgcct
gaggggctgctggccaccgtcactgtgtgcctgaccctgaccgccaagcgcatggcgagg
aagaactgcctggtgaagaatctggaggcggtggagacgctgggctccacgtccgtcatc
tgctcggacaagacaggcaccctcacccagaaccgcatgatcgtcgcccacatgtggttc
gatgagaccacatatgaggtggacaccagcaaagaacagactgggaaaacatttgccaat
aactctgatacctggtttaccctggcccaaatcgctggcctctgcaaccgggctgacttt
aagcctcatcaggagactctgcccattgctaagagggccacaacaggtgatgcttctgag
tcagccctcctcaagttcatcgagcagtctttcagctctgtgacggagatgagaaagaaa
aaccccaaggtggcagagattccctttaattctaccaacaagtatcagatgtccatccac
tttcgggaggacagctcccagacccacgtactgatgatgaagggtgctccggagaggatc
ttggagttttgttctacttttcttctgcatgggcaggaatattcaatggacgatgaacta
aaggaagccttccaaaatgcctgtttagaactgggaggtcttggggaacgtgtgttaggc
ttctgcttcttgaatctgcctagcagcttctccaagggattcccgtttaacacagatgaa
ataaattttcccatggataacctttgttttgtgggcctcatatccatgattgaccctccc
cgaactacagtgcctgaagctgtgaacatgtgtcgtagtgcaggaatcaaggtgatcatg
gtaacgggagatcatcccattacagctaaggccattgcccagcgtgtgggcatcatctca
gaaaacaccgagacagcagaggaagttgctgcccggctgaggatccctgtcagcaaggtt
aatcccagtgatgccaaagccattgtggtgcatggttcagagctgaaggatctacactca
gagcagcttgaccagatcctccggaaccacactgagatcgtgtttgctcggacctcccct
cagcagaagctcatcattgtggagggatgtcagaggctgggagtcattgtggccgtgaca
ggtgacggggtgaatgactcccctgcactgaagaaggctgacattggcattgccatgggc
atctctggctctgacgtctctaaacaggcggccgacatgatcctgctggacgacaacttt
gcctccatcgtcacgggggtggaggagggccgcctgatctttgacaacctgaagaaatcc
atcatgtacaccctgaccagcaacatcccagagatcacccccttcctgctgttcatcgtc
ctgggtatacccctgcctctgggcaccataaccatcctctgcattgatctaggcactgac
atggtccctgccatctccttggcttatgagtcagctgaaagcgacatcatgaagaggcgt
ccacggaacccaaagatggataaactggtgaaccaccgtctcattgccatggcctatgga
cagattgggatgatccaggctgtggctggattcttcacctactttgtaatcatggctgag
aatggctttaggcctatggatctgctgggtatccgcctctactgggaagataaattcttg
aatgacctggaggacagctatggacagcagtggacctatgagcagcgaaaagttgtggag
ttcacgtgccaaacggccttttttgtcaccattgtgcttgtgcagtgggcggatctcatc
gtctctaagactcgccgcaactcagttttccagcagggcatgagaaacaaaatcctaata
ttcgggatcctggaggagacattcttggctgcatttctgtcctacactccaggcatggac
gtggccctgagaatgtacccactcaagataagctggtggttctgtgccattccctacagc
attctcatctttgtctatgatgaaatcagaaaactcctcatccgtcagcggccaggtggc
tgggtggagagggagacctactactaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410682
Entry
100410682         CDS       T03264                                 

Gene name
ATP1A3
Definition
(RefSeq) ATPase Na+/K+ transporting subunit alpha 3
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04260  Cardiac muscle contraction
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04911  Insulin secretion
cjc04918  Thyroid hormone synthesis
cjc04919  Thyroid hormone signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04960  Aldosterone-regulated sodium reabsorption
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04964  Proximal tubule bicarbonate reclamation
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc04973  Carbohydrate digestion and absorption
cjc04974  Protein digestion and absorption
cjc04976  Bile secretion
cjc04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100410682 (ATP1A3)
   04022 cGMP-PKG signaling pathway
    100410682 (ATP1A3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100410682 (ATP1A3)
   04918 Thyroid hormone synthesis
    100410682 (ATP1A3)
   04919 Thyroid hormone signaling pathway
    100410682 (ATP1A3)
   04925 Aldosterone synthesis and secretion
    100410682 (ATP1A3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100410682 (ATP1A3)
   04261 Adrenergic signaling in cardiomyocytes
    100410682 (ATP1A3)
  09154 Digestive system
   04970 Salivary secretion
    100410682 (ATP1A3)
   04971 Gastric acid secretion
    100410682 (ATP1A3)
   04972 Pancreatic secretion
    100410682 (ATP1A3)
   04976 Bile secretion
    100410682 (ATP1A3)
   04973 Carbohydrate digestion and absorption
    100410682 (ATP1A3)
   04974 Protein digestion and absorption
    100410682 (ATP1A3)
   04978 Mineral absorption
    100410682 (ATP1A3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100410682 (ATP1A3)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100410682 (ATP1A3)
   04964 Proximal tubule bicarbonate reclamation
    100410682 (ATP1A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100410682 (ATP1A3)
Enzymes [BR:cjc01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     100410682 (ATP1A3)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100410682 (ATP1A3)
  Exosomal proteins of other body fluids (saliva and urine)
   100410682 (ATP1A3)
  Exosomal proteins of colorectal cancer cells
   100410682 (ATP1A3)
  Exosomal proteins of bladder cancer cells
   100410682 (ATP1A3)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 100410682
NCBI-ProteinID: XP_002762226
Ensembl: ENSCJAG00000012623
UniProt: F7DR43
LinkDB
Position
22
AA seq 1026 aa
MGSGGSDSYRIATSQDKKDDKGSPKKNKGKERRDLDDLKKEVAMTEHKMSVEEVCRKYNT
DCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGI
QAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEK
MQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPL
ETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITG
VAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCL
VKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHT
WVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKV
AEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKEA
FQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRA
AVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNP
RDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGD
GVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIA
YTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPR
NPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVND
LEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFG
LFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPGGWV
EKETYY
NT seq 3081 nt   +upstreamnt  +downstreamnt
atggggtctggtggctctgacagctatcgtatcgccacctcgcaggacaagaaagatgac
aagggctcgcccaagaagaataagggcaaggagcgccgggacctggatgacctcaaaaag
gaggtggctatgacagagcacaagatgtcagtggaagaggtctgccggaaatacaataca
gactgtgtgcagggtttgacccacagcaaagcacaggagatcctggcccgggatgggcct
aacgcgctcacgccgccgcctaccaccccggagtgggtcaagttttgccgccagctcttt
gggggcttctccattttgctgtggatcggggccatcctctgcttcctggcctacggtatc
caggcaggcactgaggacgacccctctggtgacaacctgtacctgggcattgtgctggcg
gccgtggtgatcatcaccggctgcttctcctactaccaggaggccaagagctccaagatc
atggagtccttcaagaacatggtgccccagcaagccctggtgatccgggaaggtgagaag
atgcaggtgaacgctgaggaggtggtagtcggggacctggtggagatcaagggtggagac
cgagtgccggctgaccttcggatcatctcagcccatggctgcaaggtggacaactcctcc
ctgactggcgaatcggagccccagacccgctctcccgactgcacgcatgacaatcccttg
gagactcggaacatcaccttcttttccaccaattgtgtggaaggcacagctcggggtgtg
gtggtggccacgggcgaccgcaccgtcatgggccgcatcgccaccctggcatcagggctg
gaggtgggcaagacgcccatcgccatcgagattgagcacttcatccagctcatcactggc
gtggctgtcttcctgggtgtctccttcttcatcctctccctcattcttgggtatacctgg
ctggaggctgtcatcttcctcatcggcatcattgtggccaatgtcccagagggtctgctg
gccactgtcacagtgtgtctgacactgaccgccaagcgtatggcccggaagaactgcctg
gtgaagaacctggaggctgtggaaactctggggtccacatccaccatctgctcagacaag
acagggaccctcactcagaaccgcatgacggtcgcccacatgtggtttgacaaccagatc
cacgaggctgacaccactgaggaccagtcagggacctcattcgacaaaagctcacacacc
tgggtggccctgtctcacatcgctgggctctgtaatcgtgctgtcttcaagggcggtcag
gacaacattcctgtgctcaagagggatgtggccggggatgcctctgagtctgccctgctc
aagtgcattgagctgtcctctggctccgtgaagctgatgcgtgagcgcaacaagaaagtg
gctgagatccccttcaattccaccaacaaataccagctctccatccatgagaccgaggac
cccaacgacaaccgatacctgctggtgatgaagggtgcccccgaacgcatcctggaccgc
tgctccaccatcctactgcagggcaaggagcagcctctggacgaggagatgaaggaggcc
ttccagaacgcctaccttgagcttggaggcctgggcgagcgcgtgcttggcttctgccat
tactacctacccgaggagcagttccccaagggctttgccttcgactgcgacgacgtgaac
ttcaccacagacaatctctgcttcgtgggcctcatgtccatgatcgaccctccccgggca
gccgtccctgatgcagtgggcaagtgtcgcagtgcaggcatcaaggtcatcatggtcact
ggcgatcaccccatcacggccaaggccattgccaagggcgtcggcatcatctctgagggc
aacgagaccgtggaggacatcgctgcccggctcaacattcccgtcagccaggtcaacccc
cgggatgccaaggcctgtgtgatccacggcaccgacctcaaggacttcacctctgagcaa
attgatgagatcctgcagaatcacactgagatcgtctttgcccgcacgtccccccagcag
aagctcatcatcgtggaaggctgtcagagacagggtgcaatcgtggctgtaactggggat
ggtgtgaacgactcccctgctctgaagaaggccgacattggggtggccatgggcatcgct
ggctctgatgtctccaagcaggcggctgacatgatcctgctggatgacaactttgcctcc
atcgtcacaggggtggaagagggccgcctgatctttgacaacctgaagaagtccattgcc
tacaccctgaccagcaacatcccggagatcacgcccttcctgctgttcatcatggccaac
atcccgctgcccctgggcaccatcaccatcctctgcatcgacctgggcactgacatggtc
cctgccatctcactggcctacgaggctgctgaaagcgacatcatgaagcgacagcccagg
aacccacggacggacaagctggtcaatgagagactcatcagcatggcctatgggcagatc
ggaatgatccaggctcttggcggcttcttctcttactttgtgatcctggcagaaaatggc
ttcttgcctggcaacctggtgggcatccggctcaactgggatgaccgcaccgtcaatgac
ctggaggacagttacgggcagcagtggacatacgagcagaggaaggtggtggagttcacc
tgccacacggccttcttcgtgagcattgtggtcgtccagtgggccgatctgatcatctgc
aagacccggaggaactcagtcttccagcagggcatgaagaacaagatcctgatctttggg
ctgtttgaggagacagccctggctgccttcctgtcctactgccctggcatggatgtggcc
ctgcgcatgtaccctctcaagcccagctggtggttctgtgccttcccctacagtttcctc
atcttcgtctacgatgaaatccgcaaactcatcctgcgcaggaaccccgggggttgggtg
gagaaggaaacctactactga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412553
Entry
100412553         CDS       T03264                                 

Gene name
ATP1B3
Definition
(RefSeq) ATPase Na+/K+ transporting subunit beta 3
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04260  Cardiac muscle contraction
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04911  Insulin secretion
cjc04918  Thyroid hormone synthesis
cjc04919  Thyroid hormone signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04960  Aldosterone-regulated sodium reabsorption
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04964  Proximal tubule bicarbonate reclamation
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc04973  Carbohydrate digestion and absorption
cjc04974  Protein digestion and absorption
cjc04976  Bile secretion
cjc04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100412553 (ATP1B3)
   04022 cGMP-PKG signaling pathway
    100412553 (ATP1B3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100412553 (ATP1B3)
   04918 Thyroid hormone synthesis
    100412553 (ATP1B3)
   04919 Thyroid hormone signaling pathway
    100412553 (ATP1B3)
   04925 Aldosterone synthesis and secretion
    100412553 (ATP1B3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100412553 (ATP1B3)
   04261 Adrenergic signaling in cardiomyocytes
    100412553 (ATP1B3)
  09154 Digestive system
   04970 Salivary secretion
    100412553 (ATP1B3)
   04971 Gastric acid secretion
    100412553 (ATP1B3)
   04972 Pancreatic secretion
    100412553 (ATP1B3)
   04976 Bile secretion
    100412553 (ATP1B3)
   04973 Carbohydrate digestion and absorption
    100412553 (ATP1B3)
   04974 Protein digestion and absorption
    100412553 (ATP1B3)
   04978 Mineral absorption
    100412553 (ATP1B3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100412553 (ATP1B3)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100412553 (ATP1B3)
   04964 Proximal tubule bicarbonate reclamation
    100412553 (ATP1B3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cjc04090]
    100412553 (ATP1B3)
CD molecules [BR:cjc04090]
 Proteins
  100412553 (ATP1B3)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 100412553
NCBI-ProteinID: XP_017821274
Ensembl: ENSCJAG00000001981
LinkDB
Position
17
AA seq 222 aa
MWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSVSDPTSYAGYIADLKKFLKPY
TLEEQKNLTTCPDGALFEQKGPVYVACQFPLLLLQACSGMSDPDFGYSKGKPCILVKMNR
IIGLKPEGVPRIDCVLKNEDQTNITTYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVTL
APSSAEKEVTVECKIDGSPNLKSQDDRDKFLGRVMFKITAHA
NT seq 669 nt   +upstreamnt  +downstreamnt
atgtgggttatgcttcagactctcaacgatgaggttccaaaatatcgtgaccagattcct
agcccaggacttatggtttttccaaaaccagtgactgcattggaatacacattcagtgtg
tctgacccaacttcctatgcagggtacattgcagaccttaagaagtttctaaaaccatat
actttagaagaacagaagaacctcacaacctgtcctgatggagcactttttgaacagaag
ggtcccgtttatgttgcatgtcagtttcctcttttgttacttcaagcatgcagtggtatg
agtgatcctgattttggctattctaaaggaaaaccttgtattcttgtgaaaatgaacaga
ataattggattaaagcctgaaggagtgccaaggatagattgtgttttgaagaatgaagat
caaacaaatataacaacttatcctcataatggaatgatagacttaaaatatttcccatat
tatgggaaaaaactgcatgtggggtatctacagccattagttgctgttcaggtcaccttg
gctcccagcagtgctgagaaagaagtaacagttgagtgcaagattgatggatcgcctaac
ctaaaaagccaggatgatcgtgacaagtttttgggacgagttatgttcaaaatcacagca
catgcatag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414358
Entry
100414358         CDS       T03264                                 

Gene name
ATP1B1
Definition
(RefSeq) ATPase Na+/K+ transporting subunit beta 1
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04260  Cardiac muscle contraction
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04911  Insulin secretion
cjc04918  Thyroid hormone synthesis
cjc04919  Thyroid hormone signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04960  Aldosterone-regulated sodium reabsorption
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04964  Proximal tubule bicarbonate reclamation
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc04973  Carbohydrate digestion and absorption
cjc04974  Protein digestion and absorption
cjc04976  Bile secretion
cjc04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100414358 (ATP1B1)
   04022 cGMP-PKG signaling pathway
    100414358 (ATP1B1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100414358 (ATP1B1)
   04918 Thyroid hormone synthesis
    100414358 (ATP1B1)
   04919 Thyroid hormone signaling pathway
    100414358 (ATP1B1)
   04925 Aldosterone synthesis and secretion
    100414358 (ATP1B1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100414358 (ATP1B1)
   04261 Adrenergic signaling in cardiomyocytes
    100414358 (ATP1B1)
  09154 Digestive system
   04970 Salivary secretion
    100414358 (ATP1B1)
   04971 Gastric acid secretion
    100414358 (ATP1B1)
   04972 Pancreatic secretion
    100414358 (ATP1B1)
   04976 Bile secretion
    100414358 (ATP1B1)
   04973 Carbohydrate digestion and absorption
    100414358 (ATP1B1)
   04974 Protein digestion and absorption
    100414358 (ATP1B1)
   04978 Mineral absorption
    100414358 (ATP1B1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100414358 (ATP1B1)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100414358 (ATP1B1)
   04964 Proximal tubule bicarbonate reclamation
    100414358 (ATP1B1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cjc04090]
    100414358 (ATP1B1)
CD molecules [BR:cjc04090]
 Proteins
  100414358 (ATP1B1)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 100414358
NCBI-ProteinID: XP_002760430
Ensembl: ENSCJAG00000010317
UniProt: F6THS7
LinkDB
Position
18
AA seq 303 aa
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLT
ISELKPTYQDRVAPPGLTQIPQIQKTEIAFRPNDPKSYEAYVLNIVRFLEKYKDSAQKEE
MIFEDCGNVPSEPKERGDLNHEQGERKVCRFKLEWLGNCSGLNDETYGYREGKPCIIIKL
NRVLGFKPKPPKNESLETYPVMKYNPYVLPVQCTGKRDEDKEKIGNVEYFGLGNYPGFPL
QYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIE
VKS
NT seq 912 nt   +upstreamnt  +downstreamnt
atggcccgcgggaaagccaaggaggagggcagttggaagaaattcatctggaactcagag
aagaaggagtttttgggcaggaccggtggcagttggtttaagatccttctattctacgta
atattttatggctgcctggctggcatcttcatcggaaccatccaagtgatgcttctcacc
atcagtgaacttaagcccacatatcaggaccgagtggccccaccaggattaacacagatt
cctcagatccagaagactgaaattgcctttcgtcctaatgatcccaagagctatgaggca
tatgtgctgaacatagttaggttcctggaaaagtacaaagattcagcccagaaggaagag
atgatttttgaagattgtggcaatgtgcccagtgaacccaaagaacgaggagaccttaat
catgaacaaggagagcgaaaggtctgcagattcaagcttgagtggctgggaaattgctct
ggattaaatgacgaaacttatggttacagagagggcaaaccatgtattattataaagctc
aaccgagttctcggcttcaaacctaagcctcccaagaatgagtccttggagacttaccca
gtgatgaagtataacccgtatgtccttcccgttcagtgcactggcaagcgagatgaagat
aaggaaaaaattggaaatgtggagtatttcggactgggcaactaccctggttttcctctg
cagtattatccctactatggcaaactcctgcagcccaaatacctgcagcccctgctggcc
gtacagttcaccaacctcaccatggacactgaaattcgcatagagtgtaaggcgtacggt
gagaacattgggtacagtgagaaagaccgttttcagggacgttttgatgtaaaaattgaa
gttaagagctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 103794919
Entry
103794919         CDS       T03264                                 

Gene name
ATP1B4
Definition
(RefSeq) ATPase Na+/K+ transporting family member beta 4
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04260  Cardiac muscle contraction
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04911  Insulin secretion
cjc04918  Thyroid hormone synthesis
cjc04919  Thyroid hormone signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04960  Aldosterone-regulated sodium reabsorption
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04964  Proximal tubule bicarbonate reclamation
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc04973  Carbohydrate digestion and absorption
cjc04974  Protein digestion and absorption
cjc04976  Bile secretion
cjc04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    103794919 (ATP1B4)
   04022 cGMP-PKG signaling pathway
    103794919 (ATP1B4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103794919 (ATP1B4)
   04918 Thyroid hormone synthesis
    103794919 (ATP1B4)
   04919 Thyroid hormone signaling pathway
    103794919 (ATP1B4)
   04925 Aldosterone synthesis and secretion
    103794919 (ATP1B4)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103794919 (ATP1B4)
   04261 Adrenergic signaling in cardiomyocytes
    103794919 (ATP1B4)
  09154 Digestive system
   04970 Salivary secretion
    103794919 (ATP1B4)
   04971 Gastric acid secretion
    103794919 (ATP1B4)
   04972 Pancreatic secretion
    103794919 (ATP1B4)
   04976 Bile secretion
    103794919 (ATP1B4)
   04973 Carbohydrate digestion and absorption
    103794919 (ATP1B4)
   04974 Protein digestion and absorption
    103794919 (ATP1B4)
   04978 Mineral absorption
    103794919 (ATP1B4)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103794919 (ATP1B4)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103794919 (ATP1B4)
   04964 Proximal tubule bicarbonate reclamation
    103794919 (ATP1B4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cjc04090]
    103794919 (ATP1B4)
CD molecules [BR:cjc04090]
 Proteins
  103794919 (ATP1B4)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 103794919
NCBI-ProteinID: XP_009000999
Ensembl: ENSCJAG00000014233
LinkDB
Position
8
AA seq 346 aa
MRRQLRSRRAPSFPYSYRYRLDDQDELNQNYLADEEEEAEEEARVMVVPKSEEEEEEKEK
KEEEEGQGQPTGNAWWQKLQIMSEYLWDPERRVFLARTGLILLTYSXLYASLAAVITLCM
YTLFLTISHYIPXFTERVNPPGVMIRPFAHSLNFNFNVSEPDTWQHYVISLNGFLQGYND
SLQEEMNVDCPPGQYFIQDGDEDEDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKM
NRIVGFRPELGDPVKVSCKVQRGDENDIRSIRYYPESASFDLRYYPYYGKLTHVNYTSPL
VAMHFTDVVKNQAVPVQCQLKGKGIINDVINDRFVGRVIFTLNIET
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgagaaggcaactccggtccagaagggctccatcctttccttacagttatcgctacaga
ctcgatgatcaggatgaactgaaccagaactacttagccgatgaagaggaggaagcagaa
gaagaggctcgggtgatggtggtgcccaagtcagaggaggaggaagaagaaaaggagaaa
aaggaggaggaagagggtcagggtcagccaacaggcaatgcttggtggcagaaattgcag
atcatgagcgaatacctgtgggatccagagagaagagtgtttctggcccgaacaggcctg
atcttactcacttattccnntctctatgcctccctggctgctgtgatcaccctctgcatg
tacacactatttctgaccatcagtcattatataccanacttcacggagcgggtaaatcct
cctggagttatgatcagacccttcgcccatagccttaacttcaacttcaacgtttctgaa
cctgacacttggcagcattatgtgattagcctaaatggcttcctccagggttataatgac
agtcttcaagaggaaatgaatgtagattgtcccccggggcagtacttcatccaagatggt
gatgaggatgaggacaagaaggcctgccaatttaagcgctctttcctaaagaactgctct
ggtctggaggacccaacttttggatactctactggacagccatgcatccttctaaagatg
aaccggattgtaggctttcgtcctgagcttggagatcctgtgaaggtttcctgcaaagtt
cagagaggtgatgaaaatgacatccgatccatcaggtactacccagagtcggcttctttt
gacctccgctactacccttactacggcaaactgactcacgttaactatacctccccgctg
gtggcaatgcactttacagacgtggtgaagaaccaagcagtgcctgtgcagtgccaactg
aagggcaaaggcatcataaatgatgtcatcaatgatcgttttgtgggcagggtaatcttt
accctgaacatagaaacctaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 103796045
Entry
103796045         CDS       T03264                                 

Gene name
FXYD2
Definition
(RefSeq) FXYD domain containing ion transport regulator 2
  KO
K01538  sodium/potassium-transporting ATPase subunit gamma (FXYD domain-containing ion transport regulator 2)
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04260  Cardiac muscle contraction
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04911  Insulin secretion
cjc04918  Thyroid hormone synthesis
cjc04919  Thyroid hormone signaling pathway
cjc04960  Aldosterone-regulated sodium reabsorption
cjc04961  Endocrine and other factor-regulated calcium reabsorption
cjc04964  Proximal tubule bicarbonate reclamation
cjc04970  Salivary secretion
cjc04972  Pancreatic secretion
cjc04973  Carbohydrate digestion and absorption
cjc04974  Protein digestion and absorption
cjc04976  Bile secretion
cjc04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    103796045 (FXYD2)
   04022 cGMP-PKG signaling pathway
    103796045 (FXYD2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103796045 (FXYD2)
   04918 Thyroid hormone synthesis
    103796045 (FXYD2)
   04919 Thyroid hormone signaling pathway
    103796045 (FXYD2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103796045 (FXYD2)
   04261 Adrenergic signaling in cardiomyocytes
    103796045 (FXYD2)
  09154 Digestive system
   04970 Salivary secretion
    103796045 (FXYD2)
   04972 Pancreatic secretion
    103796045 (FXYD2)
   04976 Bile secretion
    103796045 (FXYD2)
   04973 Carbohydrate digestion and absorption
    103796045 (FXYD2)
   04974 Protein digestion and absorption
    103796045 (FXYD2)
   04978 Mineral absorption
    103796045 (FXYD2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103796045 (FXYD2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103796045 (FXYD2)
   04964 Proximal tubule bicarbonate reclamation
    103796045 (FXYD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjc02000]
    103796045 (FXYD2)
   04147 Exosome [BR:cjc04147]
    103796045 (FXYD2)
Transporters [BR:cjc02000]
 Other transporters
  Pores ion channels [TC:1]
   103796045 (FXYD2)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103796045 (FXYD2)
SSDB
Motif
Pfam: ATP1G1_PLM_MAT8
Other DBs
NCBI-GeneID: 103796045
NCBI-ProteinID: XP_009005135
LinkDB
Position
11
AA seq 109 aa
MPPPRGGYQTPSEKQRQQEEGGEAIHSSGEMTGLSTGDGGSPQADMDPFYYDYETVRKGG
LIFAGLAFIVGLLIILSKWGGLQGWGAGRDTSLLKAAEQAGFPESPREG
NT seq 330 nt   +upstreamnt  +downstreamnt
atgcccccacctcgcggaggctaccagacaccctccgaaaagcagagacagcaggaagag
ggaggggaggcaatccattcttctggggaaatgaccgggctgtctacgggcgatggcggc
agcccccaggcggacatggacccattctactacgactatgagactgtccgcaaagggggc
ctgatcttcgctgggctggccttcatcgtggggctcctcatcatcctcagtaagtggggt
ggcctccagggatggggtgctggccgggacacatctcttcttaaggctgctgagcaggct
ggctttccagagtccccgagggaggggtga

DBGET integrated database retrieval system