KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392193
Entry
100392193         CDS       T03264                                 

Gene name
ATF4
Definition
(RefSeq) activating transcription factor 4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04137  Mitophagy - animal
cjc04141  Protein processing in endoplasmic reticulum
cjc04151  PI3K-Akt signaling pathway
cjc04210  Apoptosis
cjc04211  Longevity regulating pathway
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04668  TNF signaling pathway
cjc04720  Long-term potentiation
cjc04722  Neurotrophin signaling pathway
cjc04725  Cholinergic synapse
cjc04728  Dopaminergic synapse
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04915  Estrogen signaling pathway
cjc04918  Thyroid hormone synthesis
cjc04922  Glucagon signaling pathway
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04932  Non-alcoholic fatty liver disease
cjc04934  Cushing syndrome
cjc04935  Growth hormone synthesis, secretion and action
cjc05010  Alzheimer disease
cjc05012  Parkinson disease
cjc05014  Amyotrophic lateral sclerosis
cjc05020  Prion disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05030  Cocaine addiction
cjc05031  Amphetamine addiction
cjc05034  Alcoholism
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05203  Viral carcinogenesis
cjc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100392193 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100392193 (ATF4)
   04668 TNF signaling pathway
    100392193 (ATF4)
   04022 cGMP-PKG signaling pathway
    100392193 (ATF4)
   04151 PI3K-Akt signaling pathway
    100392193 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100392193 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    100392193 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100392193 (ATF4)
   04922 Glucagon signaling pathway
    100392193 (ATF4)
   04912 GnRH signaling pathway
    100392193 (ATF4)
   04915 Estrogen signaling pathway
    100392193 (ATF4)
   04926 Relaxin signaling pathway
    100392193 (ATF4)
   04935 Growth hormone synthesis, secretion and action
    100392193 (ATF4)
   04918 Thyroid hormone synthesis
    100392193 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    100392193 (ATF4)
   04925 Aldosterone synthesis and secretion
    100392193 (ATF4)
   04927 Cortisol synthesis and secretion
    100392193 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100392193 (ATF4)
  09156 Nervous system
   04725 Cholinergic synapse
    100392193 (ATF4)
   04728 Dopaminergic synapse
    100392193 (ATF4)
   04720 Long-term potentiation
    100392193 (ATF4)
   04722 Neurotrophin signaling pathway
    100392193 (ATF4)
  09149 Aging
   04211 Longevity regulating pathway
    100392193 (ATF4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100392193 (ATF4)
  09162 Cancer: specific types
   05215 Prostate cancer
    100392193 (ATF4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100392193 (ATF4)
   05012 Parkinson disease
    100392193 (ATF4)
   05014 Amyotrophic lateral sclerosis
    100392193 (ATF4)
   05020 Prion disease
    100392193 (ATF4)
   05022 Pathways of neurodegeneration - multiple diseases
    100392193 (ATF4)
  09165 Substance dependence
   05030 Cocaine addiction
    100392193 (ATF4)
   05031 Amphetamine addiction
    100392193 (ATF4)
   05034 Alcoholism
    100392193 (ATF4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100392193 (ATF4)
   04934 Cushing syndrome
    100392193 (ATF4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100392193 (ATF4)
   05161 Hepatitis B
    100392193 (ATF4)
   05163 Human cytomegalovirus infection
    100392193 (ATF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100392193 (ATF4)
Transcription factors [BR:cjc03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    100392193 (ATF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF3450 DUF4407 Fez1 Nop53 DUF4795 Laminin_II AAA_13 bZIP_Maf
Other DBs
NCBI-GeneID: 100392193
NCBI-ProteinID: XP_002763954
Ensembl: ENSCJAG00000002594
UniProt: H9KVU9
LinkDB
Position
Un
AA seq 351 aa
MTEMSFLSSEVLEGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSE
WLAVDGLVSAPNNGKEDAFSGTDWMLEKMDLKEFDFDSLLATDDLETMTDELLATLDDTC
DLFAPLVQETNKEPPQAVNPIGHLPESLTKPDQVAPFTFLEPLPLSPGVLSTTPDHSFSL
ELGSEVGISEGDTKSDSTAYIAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSARG
SPNRSLTSPGVLCDSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKR
AEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgaccgagatgagtttcctgagcagcgaggtgttggagggggacttgatgtcccccttc
gaccagtcgggtttgggggctgaggaaagcctaggtctcttagatgactacctggaggtg
gccaagcacttcaaacctcatgggttctccagcgacaaggctaaggcgggctcctccgaa
tggctggctgtggatgggttggtcagtgcccccaacaacggcaaggaggatgctttctcc
gggacagattggatgttggagaaaatggatctgaaagagtttgactttgattccctgttg
gctacagatgacctggaaaccatgacagatgagcttttggccacgttagatgacacatgt
gacctctttgccccgctagtccaggagactaataaggagcccccccaggcggtgaaccca
attggccatctcccagaaagtttaacaaaacccgaccaggttgcccctttcaccttcttg
gaacctcttcccctatcccccggggtcctctccaccactccagatcattcctttagttta
gaactgggcagtgaagtaggtatctctgaaggagatacgaagtcagactccactgcttac
atagccatgatcccgcagtgcataaaggaggaagacaccccctcagataatgatagtggc
atctgtatgagcccagagtcctatttgggctccccccagcatagcccctctgccaggggc
tccccaaataggagcctcacatctccaggtgtcctctgtgactctgcccgtcccaaacct
tacgaccctcctggagagaaaatggtagcagcaaaagtaaagggtgagaaactggataag
aaactgaaaaaaatggagcaaaacaagacagcagccactaggtaccgccagaagaagagg
gcagagcaggaggccctcactggtgagtgtaaggagctggaaaagaagaacgaagctcta
aaagagagggcagattccttggccaaggagatccaatacctgaaagatttgatagaagag
gtccgcaaggcaagggggaagaaaagggtcccctag

DBGET integrated database retrieval system