KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392446Help
Entry
100392446         CDS       T03264                                 

Gene name
MANEAL
Definition
(RefSeq) mannosidase endo-alpha like
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_99 Glyco_hydro_71 DUF5010
Motif
Other DBs
NCBI-GeneID: 100392446
NCBI-ProteinID: XP_002750670
Ensembl: ENSCJAG00000002066
LinkDB All DBs
Position
7
AA seq 457 aa AA seqDB search
MARRRRRACIALFLVLLFAFGTLMGLRTLKAPDGLPALGPGLELAPFERRPEGAPAPAAR
APAAPAAPPPPPPPPRTADPGGSPEPAPVEAEPAPGQSLRVYSDLHAFYYSWYGSPRREG
HYIHWDHVMVPHWDPKISASYPRGRHSPPDDLGSSFYPELGPYSSRDPEVLREHMTQLKE
AAIGVLVLSWYPPGMADDNGEPSDDLVPAILDTAHQYSIQVAFHIQPYKGRDDITVHDNI
KYIIDTYGSHGAFYRYKNSMGKSLPLFYIYDSYLTSPEAWAHLLTPNGPHSIRNTPYDGV
FIALLVEEGHTHDILAAGFDGMYTYFASNGFSFGSSHQNWKAVKNFCDANNLMFIPSVGP
GYIDTSIRPWNNHNTRNRVNGKYYETALQAALTVRPEIVSITSFNEWHEGTQIEKAIPKK
TPTRLYLDYLPHQPSLYLELTRRWAEHFIKEKEQWLM
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcccggcggcggcgccgcgcctgcatcgcgttgttcctggtgctgctcttcgccttc
ggcaccctcatgggcctgcgcacgctcaaggctccggacggactcccggcgctgggccca
ggcctggagctggcgccctttgaacgacgcccggagggggcccccgcacccgccgccagg
gccccggcggcccctgccgctccgcccccgccgccgccgccgccccgcaccgcggaccct
ggcggttcccctgagccggcccccgtggaggccgagcccgcccccgggcagagcctgaga
gtctactcggacctgcacgccttctactactcgtggtacgggagcccgcggcgcgagggc
cactacattcactgggaccacgtcatggtgccgcactgggaccccaagatctcggccagt
tacccccgcggccgccacagccccccagacgacttgggctccagcttctacccggagctg
ggaccctacagctcccgggaccccgaagtgctgcgggagcacatgacccagctcaaggaa
gccgccatcggcgttctggttctgtcctggtacccacctggcatggctgatgataatggg
gaaccctcagatgacctggtacccgccattctggacactgcccatcagtacagcatccag
gtggccttccacatccaaccctacaagggccgggatgacatcactgtacatgacaacatc
aagtacatcattgacacgtatggctcccatggtgcattttaccgctataagaacagcatg
ggcaagagcctcccactcttttatatctacgactcatacctgacgtcccctgaggcctgg
gcccacctcctgacaccaaatgggccccactcgatccgcaacacaccctatgatggggtc
ttcatagcactgctggtggaggagggccacacccacgacatcctggctgccggatttgac
ggcatgtacacctactttgcctccaacggtttctcctttggttcttcccatcagaactgg
aaagctgtgaagaacttttgtgatgccaacaacctcatgttcatccccagtgtggggcct
ggctatatagacaccagcatccggccctggaacaaccacaatacacgcaacagggtcaac
ggcaagtactatgagaccgccctgcaggcggccctgacagtgaggcccgagatcgtctcc
atcacctccttcaatgagtggcacgagggcacccagattgagaaggccattcccaagaag
acacccacccgcctgtatttggactacctgcctcaccagcccagcctgtacctggagctg
acccgccgctgggcggagcacttcatcaaagagaaagagcagtggctcatgtga

DBGET integrated database retrieval system