KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392482Help
Entry
100392482         CDS       T03264                                 

Gene name
UTF1
Definition
(RefSeq) undifferentiated embryonic cell transcription factor 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
SSDB OrthologParalogGFIT
Motif
Pfam: Myb_DNA-bind_4 Myb_DNA-bind_6 Myb_DNA-binding
Motif
Other DBs
NCBI-GeneID: 100392482
NCBI-ProteinID: XP_008977206
Ensembl: ENSCJAG00000005071
UniProt: F7I6C1
LinkDB All DBs
Position
12
AA seq 342 aa AA seqDB search
MLLRPRRPPPLAPLSPTSPDREPRPPGDAPATPPRRPASPSALGEVMSPVSPGSAQRTPW
TARETELLLDTLLEPGVWRALLLDRRQALPTYRRVSAALARQQVRRTPAQCRRRYKFLKD
KFREAHGQPSGPFDDQIRQLMGLLGDNGRKRPRRRSPGPGRPQRGRRPAPSAPALAPSVP
GAAQLPATRDPDADPAWRLRFSPSPPKSADVARAPSSPPTPAPTALATCLPEDRAPVPRG
PSSPPPPAPDPTREDPDSPPGRPEDRAPPPAAPPSLNAALLQTLGHLGDIVGILGPLRDQ
LLTLNQHVEQLRGAFDQTVSLAVGFILGSAAAERGVFRDPCQ
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgctactccggccccggaggccgccgcccctcgcgccactgtcgccgaccagccccgac
cgcgagccgcggcctcccggagacgccccagcgaccccgccccggaggcccgcctcgccg
agcgcgctgggggaggtcatgtcgccggtctccccgggctccgcgcagcgcacgccctgg
accgcgcgggagacggagctgctgctggacacgctgctggagccgggcgtgtggcgcgcg
ctgctcctggaccgccgccaggcgctgcccacctaccgccgcgtgtcggctgcgctggcc
cggcagcaggtgcgccgcacccccgcgcagtgccgccgccgctacaagtttctcaaggac
aagttccgcgaggcgcacggccagccgtccgggcccttcgacgaccagatccggcagctc
atggggctgctgggcgacaacgggcgaaaacggccccgccgccgctccccgggacccggg
cgcccacagcgcggccgccgcccggcccccagcgcgcccgcgctcgctccgagcgtacca
ggcgccgcacagctgccggccacccgcgaccccgacgcggaccccgcctggaggctccgc
ttcagcccgtccccgccgaagtctgcggatgtcgcccgcgcccccagctccccgcccacc
cccgccccaacagccctcgccacctgcctcccggaggaccgcgcgcccgttcctcgcggc
cccagttccccaccgccgccagcccccgacccgacccgcgaggaccccgactcaccgccc
ggccgccccgaggaccgcgcgccccctccggccgctcccccgtcgctgaacgccgccctg
ctgcagaccctggggcacctgggcgacatcgtgggtatcctgggccctttgcgcgaccag
ctgctgaccctgaaccagcacgtggagcagctgcgcggcgccttcgaccagaccgtgtcc
ctggccgtgggcttcatcctgggcagtgcggccgccgagcgaggggtcttcagggacccg
tgccagtga

DBGET integrated database retrieval system