KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392518
Entry
100392518         CDS       T03264                                 

Gene name
IKBKE
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit epsilon
  KO
K07211  inhibitor of nuclear factor kappa-B kinase subunit epsilon [EC:2.7.11.10]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05171  Coronavirus disease - COVID-19
cjc05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100392518 (IKBKE)
   04621 NOD-like receptor signaling pathway
    100392518 (IKBKE)
   04622 RIG-I-like receptor signaling pathway
    100392518 (IKBKE)
   04623 Cytosolic DNA-sensing pathway
    100392518 (IKBKE)
   04625 C-type lectin receptor signaling pathway
    100392518 (IKBKE)
   04657 IL-17 signaling pathway
    100392518 (IKBKE)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    100392518 (IKBKE)
   05160 Hepatitis C
    100392518 (IKBKE)
   05171 Coronavirus disease - COVID-19
    100392518 (IKBKE)
   05164 Influenza A
    100392518 (IKBKE)
   05162 Measles
    100392518 (IKBKE)
   05168 Herpes simplex virus 1 infection
    100392518 (IKBKE)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100392518 (IKBKE)
   05169 Epstein-Barr virus infection
    100392518 (IKBKE)
   05165 Human papillomavirus infection
    100392518 (IKBKE)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100392518 (IKBKE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100392518 (IKBKE)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     100392518 (IKBKE)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100392518 (IKBKE)
SSDB
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD PK_Tyr_Ser-Thr ABC1 Pkinase_fungal Kinase-like APH zf-RING_9 RIO1
Other DBs
NCBI-GeneID: 100392518
NCBI-ProteinID: XP_008983811
Ensembl: ENSCJAG00000018679
UniProt: F7IAT5
LinkDB
Position
19
AA seq 716 aa
MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTVSYLRPREVQVREFEVLR
KLNHQNIVKLFAVEETGGSRQKVLVMEYCSSGSLLSMLESPENAFGLPEDEFLVVLRCVV
AGMNHLRENGIVHRDIKPGNIMRLMGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYL
HPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPRRNKEIMYRITTE
KPAGAIAGTQRRENGPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAKCWGFDQFFA
ETSDILQRVVVHVFSLSQAVLHHIYIHAHNTIAIFQEAVHKQTSVAPRHQEYLFEGHLCV
LEPSISAQHIAHTTASSPLTLFSTAILKGLAFRDPALDVPKFVPKVDLQADYNTAKGVLG
AGYQALRLARALLDGQELMLQGLHQVLEVLQATCRRTLEVARTSLLFLSSSLGTERFSSM
AGTPEIQELKAATELRSRLRTLAEVLSRCSQNIIETQESLSSLRLELVKSRDQVHEERSI
QQIQCCVDKMNLIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKY
QASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESLSKILEELSHQLLQDRARG
ALASSPPISPHPSPTPKDLLLHMQELCQGMKLLASDLLDNNRTIERLSRVPAAPDV
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgcagagcaccgccaattacctgtggcacacagatgacctgctggggcagggggccact
gccagtgtgtacaaggcccgcaacaagaaatccggggagctagttgctgtgaaggtcttc
aataccgtcagctacctgcggccccgagaggtgcaggtgagggagtttgaggtcctgcgg
aagctgaaccaccagaacatcgtcaagctctttgcagtggaggagacggggggcagccgg
cagaaggtgctggtgatggaatactgctccagtgggagcctgctgagcatgctggagagc
ccggagaatgccttcgggctgccggaggatgaattcctggtggtgctgcgctgtgtggtg
gcaggcatgaaccacctgcgggagaacggcattgtgcatcgcgacatcaagcctgggaac
atcatgcggctcatgggggaggaggggcagagcatctacaagctgaccgacttcggggcc
gcccgggagctggatgatgatgagaagttcgtctcggtctatgggactgaggagtacctg
cacccggacatgtatgagcgggcagtgcttcgaaagccccagcaaaaagcattcggggtg
actgtggatctctggagcattggcgtgaccctgtaccatgcagccaccggcagcctgccc
tttattccctttggtgggccacgtcggaacaaggagatcatgtaccggatcaccacagag
aagccagctggggccattgctggtactcagaggcgggagaacggtcccttggagtggagc
tacaccctccccatcacctgccagctgtcactggggctgcagagccagctggtacccatc
ctggccaacatcctggaggtggagcaggccaagtgctggggcttcgaccagttctttgcg
gagaccagtgacatcctgcagcgagttgtcgtccatgtcttctccctgtcccaggcagtc
ctgcaccacatctacatccatgcccacaacacgatagccattttccaggaggctgtgcac
aagcagaccagcgtggccccccggcaccaggagtacctctttgagggtcacctctgtgtc
ctcgagcccagcatctcagcacagcacatcgcccacacaacagcaagcagccctctgacc
ctcttcagcacagccatcctcaaggggctggccttcagggatcctgctctggatgtcccc
aagttcgtccccaaagtggacctgcaggcagattacaacacggccaagggcgtgttggga
gccggctaccaggccctgcggctggcgcgggccctgctggatgggcaggagctgatgttg
caggggctgcaccaggtcttggaggtgctccaggccacatgcaggcggactctggaggtg
gcgaggacatccctcctcttccttagcagcagcctgggcactgagaggttcagcagcatg
gctggaacacctgagatccaggaactcaaggcagccacagaactgaggtccaggctgcgg
actctagctgaggtcctctccagatgctcccaaaatatcatagagacccaggagagcctg
agcagcctgcgcttggagttggtgaagagccgggatcaggtacatgaggaaagaagcatc
cagcagattcagtgctgtgtggacaagatgaacctcatctacaaacagttcaagaagtct
aggatgaggccagggctcggctacaacgaggagcaaattcacaagctggataaggtgaat
ttcagtcatttagccaaaaggcttctgcaggtgttccaagaggagtgcgtgcagaagtat
caagcgtccctagtcacgcacggcaagaggatgagggtggtgcacgagaccaggaaccac
ctgcgcctggtcggctgttctgtggctgcctgtaacacagaagcccagggggtccaggag
agtctcagcaagatcctggaagagctctctcaccagctccttcaggaccgagcacggggg
gctctggcctcctcaccgcccatatctcctcatcccagccctacaccaaaggacctgctt
ctccacatgcaagagctctgccaggggatgaagctgctggcatctgaccttctggacaac
aaccgcaccatcgaacggctaagtagagtcccagcagctcctgatgtctga

DBGET integrated database retrieval system