KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392898Help
Entry
100392898         CDS       T03264                                 

Gene name
HTR1B
Definition
(RefSeq) 5-hydroxytryptamine receptor 1B
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04024  cAMP signaling pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04726  Serotonergic synapse
cjc04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100392898 (HTR1B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100392898 (HTR1B)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    100392898 (HTR1B)
  09157 Sensory system
   04742 Taste transduction
    100392898 (HTR1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100392898 (HTR1B)
G protein-coupled receptors [BR:cjc04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    100392898 (HTR1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 100392898
NCBI-ProteinID: XP_002746791
Ensembl: ENSCJAG00000022374
LinkDB All DBs
Position
4
AA seq 391 aa AA seqDB search
MEEHGAQCAPPPPAGSENLVPEANLSSAPSHNCSAAEGYIYQDSIALPWKVLLVMLLALI
TLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQ
VVCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSIS
ISLPPFFWRQAKAEEEVSDCVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRI
LKQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALL
EKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLAMPICKDACWFHLAIFDFFTWLGY
LNSLINPIIYTMSNEDFKQAFHKLIRFKCTS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggaagaacacggtgctcagtgcgctccaccgccgcccgcgggctccgagaacctggtt
cctgaagccaacctatcctctgctccctcccacaactgcagcgccgccgagggctacatt
taccaggactccatagccctaccctggaaagtactgctggttatgctactggcgctcatc
accttggccaccacgctctccaacgcctttgtgattgcaacagtgtaccggacccggaag
ctgcacaccccggctaactatctgatcgcctccctggcggtcaccgacctgctcgtgtcc
atcctggtgatgcccatcagcaccatgtacactgtcaccggccgctggacactgggccag
gtggtctgtgacttctggctgtcgtcggacatcacttgttgcactgcctccatcctgcat
ctctgtgtcatcgccctggaccgctactgggccatcacggacgccgtggagtactcagct
aaaaggactcccaagagggcggcggtcatgatcgcgctggtatgggtcttctccatctcc
atctcgctgccgcccttcttctggcgtcaggccaaggccgaagaggaggtgtcggactgc
gtggtgaacaccgaccacatcctctacacggtctactccacggtgggtgctttctacttc
cccaccctgctcctcatcgccctctacggccgcatctacgtggaagcccgctcccggatt
ttgaaacagacgcccaacaggaccggcaagcgcttgacccgagcccagctgataaccgac
tcccccgggtccacgtcctcggtcacctctattaactcgcgggttcccgacgtgcctagc
gaatctgggtctcctgtgtacgtgaaccaagttaaagtgcgagtctccgacgccctgctg
gaaaagaagaaactcatggccgctagggagcgcaaagccaccaagaccttggggatcatt
ttgggagccttcattgtgtgttggctgcccttcttcatcatctcgctggcgatgcctatc
tgcaaagatgcctgctggttccacctagccatctttgacttcttcacttggctgggctat
ctcaactccctcattaaccccatcatctataccatgtccaatgaggactttaaacaagcg
ttccataaactgatacgttttaagtgcacaagttga

DBGET integrated database retrieval system