KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392997
Entry
100392997         CDS       T03264                                 

Gene name
HBEGF
Definition
(RefSeq) heparin binding EGF like growth factor
  KO
K08523  heparin-binding EGF-like growth factor
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04012  ErbB signaling pathway
cjc04912  GnRH signaling pathway
cjc04915  Estrogen signaling pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc05171  Coronavirus disease - COVID-19
cjc05205  Proteoglycans in cancer
cjc05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100392997 (HBEGF)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100392997 (HBEGF)
   04915 Estrogen signaling pathway
    100392997 (HBEGF)
   04928 Parathyroid hormone synthesis, secretion and action
    100392997 (HBEGF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100392997 (HBEGF)
  09162 Cancer: specific types
   05219 Bladder cancer
    100392997 (HBEGF)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100392997 (HBEGF)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100392997 (HBEGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100392997 (HBEGF)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100392997 (HBEGF)
SSDB
Motif
Pfam: EGF
Other DBs
NCBI-GeneID: 100392997
NCBI-ProteinID: XP_002806639
Ensembl: ENSCJAG00000016803
UniProt: U3DCM7
LinkDB
Position
2
AA seq 208 aa
MKLPPSVVLKLFLAAVLSALVTGDSLERLRRGLAAGTSNPDPPTGSTDQLLPLGGGRDWK
VRDLQEADLDLLRVTLSSKPQALATPSKEEHGKRKKKSKGLGKKRDPCLRKYKDFCIHGE
CKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYDVENEEKVKLGMTNSH
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaagctgccgccgtcggtggtgctgaagctctttctggctgcagttctctcggcgctg
gtgactggcgatagcctggagcggcttcggagagggctagctgctggaaccagcaacccg
gaccctcccactggatccacggaccagctgctgcccctaggaggcggccgggactggaaa
gtccgtgacttgcaagaggcagatctggaccttttgagagtcactttatcctccaagcca
caagcactggccacaccaagcaaggaggagcacgggaaaagaaagaagaagagcaagggg
ttagggaagaagagagacccatgtcttcggaaatacaaggacttctgcatccatggagaa
tgcaaatatgtgaaggagctccgggctccctcctgcatctgccatccaggttatcacgga
gagagatgtcatgggcttagcctcccagtggaaaatcgcttatatacctatgaccacaca
actatcctggccgtggtggccgtggtgctgtcatctgtttgtctgctggtcatcgtgggg
cttctcatgtttaggtaccataggagaggaggttatgatgtggaaaatgaagagaaagtg
aagttgggcatgactaattcccactga

DBGET integrated database retrieval system