KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393085Help
Entry
100393085         CDS       T03264                                 

Gene name
SNRPN
Definition
(RefSeq) small nuclear ribonucleoprotein polypeptide N
  KO
K11100  small nuclear ribonucleoprotein N
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    100393085 (SNRPN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LSM
Motif
Other DBs
NCBI-GeneID: 100393085
NCBI-ProteinID: XP_002753951
Ensembl: ENSCJAG00000007029
LinkDB All DBs
Position
10
AA seq 250 aa AA seqDB search
MDIGFGGTAIMTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRK
IKPKNAKQPEREEKQVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGVGRAA
GRGVPAGVPIPQAPAGLAGPVRGVGGPSKQVMTPQGRGTVAAAAVAATASIAGAPTQYPP
GRGTPPPPVGRATPPPGIMAPPPGMRPPMGPPIGLPPARGTPIGMPPPGMRPPPPGIRGP
PPPGMRPPRP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggacattggatttggtggaacagcaatcatgactgtgggcaagagtagcaagatgctg
cagcacattgactatagaatgagatgcatcctacaagatggccgaatcttcattggcacc
tttaaggcttttgacaagcatatgaatttgatcctctgtgattgtgatgagttcagaaag
atcaagccaaagaatgcgaagcaaccagagcgtgaagaaaagcaggttttgggtctggtg
ttgctacgtggggagaacttggtatccatgactgtggaggggccaccccccaaagatact
ggcattgctcgggtaccacttgctggagctgcaggaggccctggggttggtagggcagct
ggtagaggagtaccagctggtgtgccaattccccaggcccctgctggattagcaggccct
gtccgaggagttggaggcccatccaagcaggtaatgactccacagggaagaggcactgta
gcagctgccgctgttgctgcgactgccagcattgctggagccccaacacagtacccacca
ggacggggaactccgcccccacctgtcgggagagcaaccccacctccaggcattatggct
cctccacctggtatgagaccacccatgggcccaccaattgggcttccccctgctcgaggg
acaccaataggtatgccccctccgggaatgagaccccctccaccaggcattagaggtcca
cctcccccaggaatgcgtccaccaagaccctag

DBGET integrated database retrieval system