KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393248
Entry
100393248         CDS       T03264                                 

Gene name
SKP2
Definition
(RefSeq) S-phase kinase associated protein 2
  KO
K03875  F-box and leucine-rich repeat protein 1 (S-phase kinase-associated protein 2)
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04068  FoxO signaling pathway
cjc04110  Cell cycle
cjc04120  Ubiquitin mediated proteolysis
cjc04150  mTOR signaling pathway
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100393248 (SKP2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100393248 (SKP2)
   04150 mTOR signaling pathway
    100393248 (SKP2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100393248 (SKP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100393248 (SKP2)
   05203 Viral carcinogenesis
    100393248 (SKP2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100393248 (SKP2)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100393248 (SKP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100393248 (SKP2)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     100393248 (SKP2)
SSDB
Motif
Pfam: F-box-like F-box F-box_5
Other DBs
NCBI-GeneID: 100393248
NCBI-ProteinID: XP_002745101
Ensembl: ENSCJAG00000018275
UniProt: U3E4N9
LinkDB
Position
2
AA seq 424 aa
MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLG
IPQSPPRKRLKSKGSDKDFVIIRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKV
SGVCRRWYRLAFDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSP
FRVQHMDLSNSVIEVSTLQGILSQCSKLQNLSLEGLRLSDPIVNNLAQNSNLVRLNLCGC
SGFSEFALQTLLSGCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKS
DLSTLVRRCPNLVHLDLSDSIMLKNDCFPEFFQLNYLQHLSLSRCYDIIPETLLELGEIP
TLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIDNQKNQEIWGIKCRLTLQK
PSCL
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgcacaggaagcacctccaggagattccagacctgagtagcaacgttgccactagcttc
acgtggggatgggattccagcaagacttctgaactgctctcaggcatgggggtctccgcc
ctggagaaagaggagcccgacagtgagaacatcccccaggaactgctctcaaacctgggc
atcccgcagagccccccaaggaaacggctgaagagcaaagggagtgacaaagactttgtg
attatccgcaggcctaagctaaatcgagagaactttccaggtgtttcatgggactccctt
ccggatgagctgcttttggggatcttttcctgtctgtgcctccctgagctgctaaaggtc
tctggtgtttgtaggagatggtatcgcctagcgtttgacgagtctctgtggcaaacctta
gacctcacaggtaaaaatctgcacccggatgttactggtcggttgctgtctcaaggggtg
attgccttccgctgcccacgatcatttatggaccaaccattagctgaacatttcagccct
tttcgtgtgcagcacatggacctgtcaaactcggttattgaagtgtccaccctccagggc
attctgtctcagtgttccaagttgcagaatctaagcctggaaggcctgcggctgtcggat
cccattgtcaataatcttgcgcaaaactcaaatttagttcgacttaacctttgtgggtgt
tctggattctctgaatttgccctgcagactttgctaagtggctgttccagactggatgag
ctgaacctctcctggtgctttgattttactgagaagcatgtgcaggtggctgttgcgcat
gtgtcagagaccatcacccagctgaatcttagtggctacagaaagaatctccagaaatca
gatctctctactttagttagaagatgccccaatcttgtccacctagacttaagtgacagt
atcatgctgaagaatgattgcttcccggaatttttccagctcaactacctccaacacctg
tctctcagtcggtgctatgatataatacctgaaactttacttgaacttggagaaattccc
acactaaaaacactacaagtttttggaattgtgccagatggtacccttcaactgttaaag
gaagcccttcctcatctacagattaattgctcccatttcaccaccattgctaggccaact
attgacaaccaaaagaaccaggagatatggggcatcaaatgccgactgaccctgcaaaag
cccagttgtctctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396732
Entry
100396732         CDS       T03264                                 

Definition
(RefSeq) S-phase kinase-associated protein 2-like
  KO
K03875  F-box and leucine-rich repeat protein 1 (S-phase kinase-associated protein 2)
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04068  FoxO signaling pathway
cjc04110  Cell cycle
cjc04120  Ubiquitin mediated proteolysis
cjc04150  mTOR signaling pathway
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100396732
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100396732
   04150 mTOR signaling pathway
    100396732
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100396732
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100396732
   05203 Viral carcinogenesis
    100396732
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100396732
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100396732
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100396732
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     100396732
SSDB
Motif
Pfam: F-box-like F-box
Other DBs
NCBI-GeneID: 100396732
NCBI-ProteinID: XP_017821626
LinkDB
Position
18
AA seq 371 aa
MHRKHLQEIPDLSSNIAASFXSELLSGLGVSALEKEEPEGQNIPQELLSNLGLPHSPPRK
RLKSKGSDKDFVITVLRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPEVLKVSGLFLCK
DTDFAFTDWYLWQTLDLTGQNLHPDVTGRLLSQRAIAFRCPGSFMDQPLAEHFSPFHVQH
VDLLISVIEVSTLQGILPQCSKLQNLSLEGLRLLDPVVNNLAQNSNLVRLNLCGRSGFSE
FALQTLLSGSSIRDELNLSWCFDFTGKHVQVAAAHVSDTIAQLNLSGYRKNLQKSDLSTL
VKRCPSLAHLDVNNCFPEIFQLNYLQHLSLSRCYDILRRSFALVTQAGTEILPHISISAT
LALLKHLIKAK
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgcacaggaagcacctccaggagattccagacctgagtagcaacattgccgctagcttc
nnctccgaactgctctcaggcctgggggtctccgccctggagaaagaggagcccgaaggt
cagaacatcccccaggaactgctctcaaacctgggcctcccgcacagccccccaaggaaa
cggctgaagagcaaagggagtgacaaagactttgtgattacagttctcaggcctaagcta
aatcgagagaactttccaggtgtttcatgggactcccttccggatgagctgcttttgggg
atcttttcctgtctgtgcctccctgaggtgctaaaggtctctggcctttttttatgcaaa
gacacagatttcgccttcactgactggtatctatggcaaaccttagacctaacaggtcaa
aatctgcacccagatgtgaccggtcggttgctgtctcaaagggcgattgccttccgctgc
ccaggatcgtttatggaccaaccattggctgaacattttagcccttttcatgtgcagcac
gtggacctgttgatctcagttattgaagtgtccaccctccagggcattctgcctcagtgt
tccaagttgcagaatctaagcctggaaggcctgcggctgttggatcccgttgtcaataat
ctcgcacaaaactccaatttagtgcgacttaacctttgtgggcgttctggattttctgaa
tttgccctgcagactttgctaagcggctcttccataagggatgagctgaacctctcctgg
tgttttgatttcactgggaagcatgtgcaggtggctgctgcgcatgtgtcagacaccatc
gctcagctgaatcttagcggctacagaaagaatctccagaaatcagatctctctacttta
gttaaaagatgccccagtcttgcccacctagacgtaaataactgctttccggaaattttc
cagctcaactacctccaacacctgtctctcagtcggtgctatgatattttgagacggagt
ttcgctcttgttacccaggctggaactgagatacttccgcacatctcaatatctgcaact
ttggctctattaaagcatttgataaaagcaaaatag

DBGET integrated database retrieval system