KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393644
Entry
100393644         CDS       T03264                                 

Gene name
GFAP
Definition
(RefSeq) glial fibrillary acidic protein
  KO
K05640  glial fibrillary acidic protein
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100393644 (GFAP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100393644 (GFAP)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cjc04812]
    100393644 (GFAP)
Membrane trafficking [BR:cjc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    100393644 (GFAP)
Cytoskeleton proteins [BR:cjc04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     100393644 (GFAP)
SSDB
Motif
Pfam: Filament Filament_head Spc7 DUF1664 Topoisom_I_N GAS CENP-F_leu_zip
Other DBs
NCBI-GeneID: 100393644
NCBI-ProteinID: XP_017827915
LinkDB
Position
5
AA seq 442 aa
MSQEQAEPGQDGEETHHLRCSPLLRLPGGDDGGGSGFPSSGSWQPPLPWLEWLPPLTTRV
DFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPT
KLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLGTVRQKLQDETNLRLEAENNLA
AYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPD
LTAALKEIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQ
SLTCDLESLRGTNESLERQMREQEERHAREAASYQEALERLEEEGQSLKDEMARHLQEYQ
DLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVV
KTVEMRDGEVIKESKQEHKDVM
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgtctcaggagcaagcagagccagggcaggatggagaggagacgcatcacctccgctgc
tcgccgctcctacgtctcccagggggagatgatggtggggggtctggcttcccgtcgtct
gggtcctggcagccgcctctcccttggctcgaatggctccctccactcacgactcgagtg
gacttctccctggctggggcactcaatgctggcttcaaggagacccgggccagtgagcgg
gcagagatgatggagctcaatgaccgctttgccagctacatcgagaaggttcgcttcctg
gaacagcaaaacaaggcgctggctgctgagctgaaccagctgcgggccaaggagcccacc
aagctggccgacgtctaccaggctgagcttcgagagctgcggctgcggctcgatcaactc
actgccaacagcgcccggctggaggtcgagagggacaatctggcacaggacctgggcact
gtgaggcagaagctccaggatgaaaccaacctgaggctggaagcggagaacaacctggct
gcctatagacaggaagcagatgaagccaccttggcccgtctggatctggagagaaagatc
gagtcactggaggaggagatccggttcttgaggaagatccatgaggaggaggttcgggaa
ctccaggagcagctggcccgacagcaggtccacgtggagttggacgtggccaagccagac
cttactgcagccctgaaagagatccgcacgcagtacgaggcaatggcgtccagcaacatg
catgaagccgaggagtggtaccgctccaagtttgcagacctgacagacgctgctgcccgc
aacgcggagctgctccgccaggccaagcacgaggctaacgactaccggcgtcagttgcag
tccttgacctgcgacctggagtctctgcgcggcacaaacgagtccctggagaggcagatg
cgcgagcaggaggagcgccacgcgcgggaggcggccagttaccaggaggcgctggagcgg
ctggaggaagaggggcagagcctcaaggacgagatggcccgccacttgcaggagtaccag
gacctgctcaacgtcaagctggccctggacatcgagatcgccacctacaggaaactgctg
gagggcgaggagaaccgcatcaccattcctgtgcagaccttctccaacctgcagatccga
gaaaccagcctggacaccaagtctgtgtcagaaggccacctcaagaggaacatcgtggtg
aagactgtggagatgcgggatggagaggtcattaaggagtccaagcaggagcacaaggat
gtgatgtga

DBGET integrated database retrieval system