KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393665
Entry
100393665         CDS       T03264                                 

Gene name
AOX1
Definition
(RefSeq) aldehyde oxidase 1
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00280  Valine, leucine and isoleucine degradation
cjc00350  Tyrosine metabolism
cjc00380  Tryptophan metabolism
cjc00750  Vitamin B6 metabolism
cjc00760  Nicotinate and nicotinamide metabolism
cjc00830  Retinol metabolism
cjc00982  Drug metabolism - cytochrome P450
cjc01100  Metabolic pathways
cjc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100393665 (AOX1)
   00350 Tyrosine metabolism
    100393665 (AOX1)
   00380 Tryptophan metabolism
    100393665 (AOX1)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100393665 (AOX1)
   00760 Nicotinate and nicotinamide metabolism
    100393665 (AOX1)
   00830 Retinol metabolism
    100393665 (AOX1)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100393665 (AOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100393665 (AOX1)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100393665 (AOX1)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2
Other DBs
NCBI-GeneID: 100393665
NCBI-ProteinID: NP_001295373
Ensembl: ENSCJAG00000004230
UniProt: M1ZMR7
LinkDB
Position
6
AA seq 1337 aa
MDRTPELLFYVNGRKVTEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYN
PITKRIRHHPANACLIPICSLYGAAVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPG
MVMSIYTLLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDACKTFCKTSGCCQSKENGICC
LDQGINGLPEFEEGSETSPKLFTEEEFLPLDPTQELIFPPELMVMAEKQPQRTRVFGGER
MVWFSPVTLKELLELKFKYPQAPVVMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVIHA
STGLTLGAGLSLAQVKDILADVVQKLPEEKTQMYQALLKHLRTLAGSQIRNMASLGGHII
SRHPDSDLNPLLAVGNCTLNLLSKEGKREIALNEQFLSKCPNADLKPQEILISVNIPYSR
KWEFVSAFRQAQRQENALAIVNSGMRVFFGEENGSIRELSISYGGIGPTTICAKNSCQKV
IGRLWNEEMLDTACRLVLDEVCLPGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMNSV
HYPSLADKYASALEDLHSRHHCSTLKYQKIGPKQHPEDPVGHPIMHLSGVKHATGEAIYC
DDMPPVDKELFLTFVTSSRAHAKIVSIDLSEALSMPGVVDIMTAEHLGDVNSFCFFAETE
TLLATDKVFCVGHLVCAVLADSEVQAKRAAKRVKIVYQDLEPLILTIEEAIQHNSFFKPE
RKLEYGNVDEAFKMVDHILEGEIHMGGQEHFYMETQSMLVVPKGEDQEMDVYVSTQFPKY
IQDIVASTLKLPANKVMCHVRRVGGAFGGKVFKTGTLAAVTAFAANKHGRAVRCVLERGE
DMLITGGRHPYLGKYKAGFMNDGRILALDMEHYNNAGTSLDESLLVSVLRSKLTDMLQVS
HLRCRGWACRTNLPSNTAFRGFGFPQAGLITESCIVEVAAKCGLSPEKVRMINMYKEIDQ
TPYKQEINAKNLAQCWRECMAMSSYSQRKVVVEKFNMENYWKKKGLAMVPLKFPVGLGSR
AAGQAAALVHIYLDGSVLVTHGGIEMGQGVHTKMIQVASRELRMPMSNVHLRGTSTETVP
NANISGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKGTWKDWAETAFNESISLSAVGY
FRGYESDMNWEKGEGHPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSINPALDI
GQIEGAFIQGMGLYTIEELNYSPQGVLHTRGPDQYKIPAICDMPTQLHISLLPPSQNSNT
LYSSKGLGESGVFLGCSVFFAIHDAVSAARWERGLRGPLRLNSPLTPEKIRMACEDKFTK
MIPRDEPGSYVPWNVLI
NT seq 4014 nt   +upstreamnt  +downstreamnt
atggaccggacgccggagctgctcttctacgttaacggccgcaaggtgacagaaaaaaat
gttgatcctgagacaatgctgttgccttatctgaggaagaagctccgactcacaggaacc
aagtatggctgtggaggaggaggctgtggtgcatgtacagtgatgatatcacgatataat
cccatcaccaagagaataaggcatcacccagccaatgcctgtctgattcccatctgttct
ctgtatggtgctgctgtcaccacagtagaaggcataggaagcacccacaccagaattcat
cctgttcaggagaggatcgccaagtgtcacggcacccagtgtggcttctgcacacctggg
atggtgatgtccatctacaccctgctcaggaaccacccagagcccactctggatcaatta
actgatgcccttggtggtaacctgtgccgttgcactggatacaggcccataattgatgca
tgcaagactttctgtaaaacttcaggttgctgtcaaagtaaagaaaatgggatttgctgt
ttagatcaaggaatcaatggattgccagaattcgaggaaggaagtgagacgagtccaaaa
ctcttcacagaagaggagtttctgccattggatccaacccaggaactgatatttcctcct
gagctaatggtaatggcagagaaacagccccaaaggaccagggtgtttggcggtgagaga
atggtgtggttttcccccgtgaccctgaaggaactgctggaattgaaattcaagtatccc
caggcccctgttgttatgggaaacacttctgtggggcctgaagtgaaatttaaaggtgtc
tttcacccagttataatttctcctgatagaattgaagaactcagtgttgtaatccatgca
tctactggactcacccttggtgctggtctcagcctagcccaggtgaaggacattttggct
gatgtggtccagaagcttccagaggagaagacacagatgtaccaagctctcttgaagcat
ttgagaactctggctgggtcccagatcagaaacatggcttctttagggggacacatcatt
agcaggcatccagattcagatctgaatcccctcctggctgtgggtaactgtaccctcaac
ttgctatcaaaagaaggaaaacgagagattgctttaaatgagcagttcctcagcaagtgc
cctaatgcagatcttaagcctcaagaaatcttgatctcagtgaacatcccctactcaagg
aagtgggaatttgtgtcagccttccgacaagcccagcggcaagagaatgcactagcgata
gtcaattcgggaatgagagtcttttttggagaagagaatggcagtattagagaattatcc
atctcatatggaggcattggtccaaccaccatctgtgccaagaattcctgccagaaagtc
attggaaggctctggaatgaagaaatgctggatacagcttgcaggcttgttctggatgaa
gtctgtcttccgggctcagctccaggtgggaaggtggagttcaagaggaccctcatcatc
agcttcctctttaagttctacctggaagtgtcacagattttgaaaaagatgaactcagtt
cactatcctagccttgcagacaagtatgcgagtgctttagaagatcttcattccagacat
cactgcagcacattaaagtaccagaaaataggcccaaagcagcatcccgaagacccagtt
ggccaccccatcatgcatctgtctggtgtgaagcatgccacgggggaggccatctactgt
gatgacatgcctccggtggacaaggaacttttcttgacttttgtgactagttcaagagct
catgctaagattgtgtctattgatctgtcagaagctctcagcatgcccggtgtagtggat
atcatgacagcagaacatcttggtgacgtcaattccttctgctttttcgccgaaactgag
acacttctggcaacagataaggtgttctgtgtgggtcaccttgtctgtgccgtgcttgct
gattctgaggttcaggcaaagcgagctgctaagcgagtaaagattgtctatcaagacttg
gagccactgatcctaacaattgaggaagctatacagcacaactccttcttcaagccagaa
aggaaactggaatatggaaatgttgatgaagcatttaaaatggttgatcatattcttgaa
ggtgaaatacatatgggaggtcaagaacatttttatatggaaacccaaagcatgcttgtg
gtacccaaaggagaggatcaagaaatggatgtctacgtgtccacacagtttcccaaatat
atacaggacatagttgcctcaaccttgaagctcccagctaacaaggtcatgtgtcatgta
aggcgtgttggtggagcgtttggagggaaggtgttcaagactggaacccttgcagccgtc
accgcatttgctgcaaacaaacatggccgtgcagttcgctgtgttctggaacgaggagaa
gacatgttaataactggaggccgccatccttaccttggaaagtacaaagctggattcatg
aatgatggcagaatcttggccctggacatggagcattataacaatgcaggcacctccctg
gatgaatcattattggtaagtgtcttaaggagcaagttaacggacatgctacaagtttcc
catctgcgctgccggggttgggcatgcagaaccaaccttccatccaacacggctttccgt
gggtttggatttcctcaggcagggctgatcactgaatcttgtatcgtggaagttgcagcc
aaatgtggactgtcccccgagaaggtgcgaatgataaacatgtacaaggaaattgatcaa
acaccctacaaacaagagatcaatgccaagaacctggcccaatgttggagagaatgtatg
gccatgtcttcctactcccagaggaaagtggttgtggaaaaattcaacatggagaattac
tggaagaagaaaggactggccatggtccccttgaagtttcctgtcggccttggctcccgc
gctgctggtcaggctgctgccttggttcacatttatcttgacggctcagtgctggtcact
cacggtggaattgaaatggggcagggggtccacactaaaatgattcaggtggccagccgt
gaattaagaatgccaatgtcaaatgtccacctgcgtggaacaagcacagaaaccgtccct
aatgcaaatatctctggaggttctgtggtggcagatctcaatgggttggcagtaaaggat
gcctgtcaaactcttctaaaacgccttgaacccatcatcagcaagaatcctaaaggaact
tggaaagactgggcggagactgcttttaatgaaagcattagtctttcagctgttggatac
ttcaggggttatgagtcagacatgaactgggagaaaggcgaaggccatcccttcgaatac
tttgtttatggagctgcctgttccgaggtggaaatagactgcctgacgggggatcataag
aacatcagaacagacattgtcatggatgttggctgcagtataaatccagcccttgacatc
ggccagattgaaggtgcatttattcaaggcatgggactgtatacaatagaggaactgaat
tattctccccagggtgttctgcacactcgtggtccagaccaatataaaattcctgccatc
tgtgacatgcccacacagttgcacatttctttgttgcctccctctcaaaactcaaatact
ctttattcatctaagggtctgggagagtcgggggtcttcctgggatgttccgtgtttttc
gctattcacgatgcggtgagtgcagcgcgatgggaaagaggactacgcggacccttaagg
cttaatagtcccctgacaccggagaagattaggatggcctgtgaagataagttcacaaaa
atgattccaagagatgaacctggatcctatgttccttggaatgtgctcatctaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394388
Entry
100394388         CDS       T03264                                 

Gene name
AOX2
Definition
(RefSeq) aldehyde oxidase 2
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00280  Valine, leucine and isoleucine degradation
cjc00350  Tyrosine metabolism
cjc00380  Tryptophan metabolism
cjc00750  Vitamin B6 metabolism
cjc00760  Nicotinate and nicotinamide metabolism
cjc00830  Retinol metabolism
cjc00982  Drug metabolism - cytochrome P450
cjc01100  Metabolic pathways
cjc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100394388 (AOX2)
   00350 Tyrosine metabolism
    100394388 (AOX2)
   00380 Tryptophan metabolism
    100394388 (AOX2)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100394388 (AOX2)
   00760 Nicotinate and nicotinamide metabolism
    100394388 (AOX2)
   00830 Retinol metabolism
    100394388 (AOX2)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100394388 (AOX2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100394388 (AOX2)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100394388 (AOX2)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2 DHODB_Fe-S_bind
Other DBs
NCBI-GeneID: 100394388
NCBI-ProteinID: XP_017829095
Ensembl: ENSCJAG00000033419
LinkDB
Position
6
AA seq 1337 aa
MPSTSRSDELVFFVNGRKVIERNVDPEGTLLTFLRKNLRLTGTKYACGRGGCGACTVMVS
KHDSVSKKIRHFSVTACLMPICSLYGAAVTTVEGVGSIKTRLHPVQERIAKSHGTQCGFC
TPGMVMSMYTLLRNHPQPSEEQLMEALGGNLCRCTGYRPIFESGRTFCMEANCCQQKGTG
KCCLDWGENDSSPLGKKNEICTKLFAKEEFQPLDPTQELIFPPELLRMAENPEKQTLNFY
GERVTWISPGTLKDLLELKAKHPKAPLVLGNTSLGPGMKSQGHFHPVLLSPARISELSMV
TKTSDGLTIGAGCSLAQMQVILAERISELPEEKTRTYRALLKHLRSLAGQQIRNMASLGG
HVMSRHCYSDLNPILAVGNSTLNLISAEGTRQIPLNEHFLAGLASADIEPEEILESVHIP
HSQKWEFVSAFRQAQCQQNALPHVNAGMRVLFKGGTDSIEDLHIAYGGVGAATISAHRSC
QQLLGRRWNELMLDEACRLLLDEVSLPGSAPGGQVEFKRTLVVSFLFKFYLEVLQELKKL
DGCYSEISERFLSALEDFPVTIPQGVQTYQSVDPHQPLQDPVGRPIMHLSGLKHATGEAI
FCDDIPMVDKELFMALVTSSRAHAKIISIDVSKALELPGVVDVITAEDIPGTNGAEDDKL
LAVDEVICVGQIICAVVAETDVQAKRATEKIKITYEDLEPVIFTIKDAIKHNSFLCPEKK
LEQGNVEEAFEKVDQIVEGEVHVGGQEHFYMETQRALVIPKTEDRELDIYVSTQDPAHVQ
KTVSSTLNIPISRITCHVKRVGGGFGGKAGKPAVFGAIAAVGAIKTGHPIRLVLDREDDM
LITGGRHPLFGKYKVGFMNNGRIKALDIECFINGGCTLDESELVTEFLILKLENAYKIRN
LRFQGRACMTNLPSNTAFRGFGFPQGALVTESCITAVAAKCGLPPEKIREKNMYKTIDKT
IYNQAFNPETLIRCWNECLDKSSFHSRRVQAEEFNKKNYWKKKGIAVIPMKFSVGFAATS
YHQAAALVHIYTDGSVLVTHGGSELGQGIHTKMLQVASRELKIPMSYIHICETSTATVPN
TIATAASIGADVNGRAVQNACQILLKRLEPIIKKYPEGSWEDWIEAAFEQRISLSATGYF
RGYKAFMDWEKGVGDPFPYYVYGAACSEVEIDCLTGAHKKIRTDIVMDACCSLNPAIDIG
QIEGSFIQGMGLYTTEELKYSPEGVLYSRSPDEYKIPAITDVPEEFNVSLLPPSHTPLTI
YSSKGLGESGMFLGSSVFFAIADAVAAVRRERGIAEDFTVQSPATPEWVRMACADQFTEM
IPRDDPKTFKPWSIPIA
NT seq 4014 nt   +upstreamnt  +downstreamnt
atgccttccacatcacgatcagacgagctggttttcttcgtgaacggaaggaaggtgata
gagaggaatgtggacccagaagggaccctgctgaccttcctacggaagaacttacgtctc
acaggaaccaagtacgcctgcggaagaggaggctgcggcgcctgcaccgtgatggtgtcc
aagcatgactctgtgtccaagaagataagacacttctctgtcaccgcatgcctgatgccc
atctgctctctgtatggagctgctgtcaccactgtggaaggtgttggaagcatcaaaact
aggcttcaccctgtacaggagcggatcgccaagagccacggcacccagtgtggattctgc
acccctgggatggtgatgtccatgtacacgctgctcaggaaccacccgcagccctcggag
gagcagctcatggaagccctggggggtaacctatgccgctgcactggttatcggccaata
tttgagagtggaaggaccttctgcatggaggcaaattgctgtcaacagaaaggaacagga
aaatgctgcttggattggggagaaaatgactcttccccacttggcaagaaaaatgagatt
tgcacaaagttatttgcaaaagaggagtttcagcccttggacccaacccaggagctcata
tttcccccagaactcttgaggatggcagagaatccagaaaaacaaacgctgaacttctat
ggagagagagttacctggatctcccctgggaccctcaaggatctcctggagctgaaagcg
aaacaccccaaagcccctctcgttctgggtaacacctcactgggacctggaatgaaatct
caaggacattttcatccagttctcctctctcctgcaaggatctctgagctgagtatggtg
acaaaaacaagtgatggactgacaataggtgctggctgcagcctggcccagatgcaggtc
atcttggctgagaggatatctgagctcccagaggagaaaacacggacataccgagccctc
ctgaagcacctgaggagtctggcaggccagcagatccggaatatggcatccttagggggg
catgtgatgagccggcattgctattcggacctgaatccaattcttgctgtgggcaattct
accctcaatctgatttcagcagaaggcacacggcagattcctctaaatgaacattttctt
gctgggttggcaagtgcagacattgagccagaagaaattttggaatctgtgcatatcccg
cactctcaaaagtgggaatttgtgtctgccttccgacaggctcagtgccagcagaatgcc
ttgccccacgtgaatgccggcatgcgagtccttttcaaaggaggcacagacagcattgag
gacctgcacatcgcctatggaggagtgggggctgccaccatcagtgcacacagatcctgc
cagcagctcctcgggaggcgctggaatgagctgatgctggatgaagcttgcaggctgctg
ctggatgaagtctcgctcccaggctcagccccgggtggccaggtggaattcaagaggacc
ctagtcgtcagcttcctcttcaaattctacctagaagttctacaggaactgaagaagctg
gatggctgttattctgaaatttcagaacgattcctaagtgctctagaagatttcccagtc
acaataccccagggagtccaaacgtaccagagtgtggatcctcaccagcctctccaagac
ccagttggacgccccatcatgcacctgtcaggtcttaaacatgccactggggaagccatt
ttttgtgatgacattcctatggtggataaagaacttttcatggctttggtgactagtagc
agggctcatgcaaaaatcatatcaattgatgtgtccaaggcccttgaactacctggggtc
gttgatgtgataacagctgaagacattccaggcaccaatggcgctgaagatgacaaattg
ctggctgtagatgaggtaatctgtgtgggccagatcatctgtgctgtggttgcagagaca
gatgtacaggcaaaacgagcaactgaaaagataaagatcacctatgaagatctggaaccc
gtaatcttcaccatcaaggacgccataaaacataattcattcctgtgccctgaaaaaaaa
cttgaacaaggaaacgttgaggaggcatttgaaaaagttgaccaaattgttgaaggagag
gtccatgttggaggacaggaacatttttacatggaaacacaaagagcgcttgttattccc
aagacagaggacagagaactggacatttatgtgtctacacaggacccagcccacgtgcag
aaaacagtgtcctctactttaaacatccccatcagcaggatcacctgtcatgtaaaacga
gtgggtggaggttttggagggaaggcaggaaagccagctgtatttggggcgattgcagct
gtgggtgctatcaaaactggtcatcctattcgtcttgtccttgatcgtgaagatgatatg
ttaataactggaggaaggcacccattatttggaaaatataaagtaggattcatgaacaac
gggcggatcaaagctctagacatcgagtgcttcattaatggaggatgcacgctggatgag
tctgagctggtaacagaatttctaatactaaagctggaaaatgcatataaaattcgcaac
ctcaggttccagggccgtgcatgcatgacaaatttaccatccaatacggcctttcgtgga
tttggtttcccacaaggagccctagtaacagaatcttgcatcacagctgtggcagccaaa
tgtggccttccaccagaaaagattagggagaaaaatatgtacaaaacaattgataaaacc
atctataatcaagcattcaaccccgagaccctgataagatgctggaacgaatgtctggac
aagtcttcctttcacagcagaagagtgcaagcagaagagttcaataagaagaattattgg
aagaagaaaggcattgccgttattcccatgaagttttcagttggctttgctgcaacaagc
tatcatcaggcagctgcactggttcatatctatacagatgggtctgtgttggtcacacat
ggaggcagcgaactaggacaaggtattcacaccaaaatgctacaggtggctagccgggag
ttaaaaatacctatgtcgtatatacacatctgtgaaacaagcacagcaacagtgcccaat
acaattgctacagcagcatccattggggccgatgtcaatggtagagctgtgcagaatgct
tgtcagatccttttgaaacgccttgagcccatcattaagaaatatccagaaggttcatgg
gaagactggatagaagctgcatttgaacaaagaatcagtctctcagccactggatacttc
aggggctataaggccttcatggactgggagaaaggggtgggggacccatttccttactat
gtctatggagctgcctgttctgaggttgaaattgactgcctgacaggtgctcacaagaaa
atcagaacggacatcgtcatggatgcgtgttgcagcctcaatccggccattgatattggg
cagattgaaggttcgtttattcaaggaatggggctttataccactgaagaactgaaatat
tccccagaaggtgtcctgtactctcggagcccagatgagtacaaaattccagccatcact
gatgtcccagaggagttcaatgtctccttgttgccaccgtcacacaccccactaaccatc
tattcatctaagggccttggggagtctgggatgttcctggggtcatctgtgttctttgcc
attgctgacgctgtggccgcagtacgaagagaaagaggcatagccgaggacttcacggtg
cagagcccagcaacgccagaatgggtccgaatggcctgtgcagatcaattcacagaaatg
atcccaagagatgaccctaagacatttaaaccttggtctatccctatcgcataa

DBGET integrated database retrieval system