KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393766
Entry
100393766         CDS       T03264                                 

Gene name
ELK1
Definition
(RefSeq) ELK1, ETS transcription factor
  KO
K04375  ETS domain-containing protein Elk-1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04510  Focal adhesion
cjc04910  Insulin signaling pathway
cjc04912  GnRH signaling pathway
cjc04921  Oxytocin signaling pathway
cjc05140  Leishmaniasis
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05213  Endometrial cancer
cjc05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100393766 (ELK1)
   04012 ErbB signaling pathway
    100393766 (ELK1)
   04014 Ras signaling pathway
    100393766 (ELK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100393766 (ELK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100393766 (ELK1)
   04912 GnRH signaling pathway
    100393766 (ELK1)
   04921 Oxytocin signaling pathway
    100393766 (ELK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100393766 (ELK1)
   05205 Proteoglycans in cancer
    100393766 (ELK1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100393766 (ELK1)
   05213 Endometrial cancer
    100393766 (ELK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100393766 (ELK1)
   05161 Hepatitis B
    100393766 (ELK1)
   05163 Human cytomegalovirus infection
    100393766 (ELK1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100393766 (ELK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100393766 (ELK1)
Transcription factors [BR:cjc03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    100393766 (ELK1)
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 100393766
NCBI-ProteinID: XP_002807926
Ensembl: ENSCJAG00000034978
UniProt: U3F8M5
LinkDB
Position
X
AA seq 428 aa
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCLPQPEVSVNSTMANVAPAAIH
ATPGDTASGKPGTPKGAGMAGPGSLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVV
LPNAAPAGAAAPPSGSRSTSPAPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGL
GRPLPPEVKVEGPKEELEVVGERGFVQETTKAEPEVLPQEGVPARLPAVIMDTAGQAGGP
VASSPEVSQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGTGSGLQAPGPALTPSLLPTH
TLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVV
LSPGPQKP
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggacccatctgtgacgctgtggcagtttctgctgcagctgctgagagaacagggcaat
ggccacatcatctcctggacttcacgggatggtggtgaattcaagctggtggatgcagag
gaggtggcccggctgtgggggctacgcaagaacaagaccaacatgaattacgacaagctc
agccgggccttgcggtactactatgacaagaatatcatccgcaaggtgagcggccagaag
ttcgtctacaagtttgtgtcctatcctgaagttgcagggtgctccactgaggactgcctg
ccccagccagaggtgtctgttaactccaccatggcaaatgtggcccctgctgctatacat
gccaccccaggggacactgcctcgggaaagccaggcactcccaagggtgcaggaatggca
ggcccaggtagtttggcacgcagcagccggaatgagtacatgcgctccggcctctattcc
accttcaccatccagtccctgcagccgcagccaccccctcatcctcggcctgctgtggtg
ctccccaacgcagctcctgcaggagcagcagcgcccccctcggggagcaggagcaccagt
ccagcccccttggaggcctgcttggaggctgaagaggctggcttgcctctgcaggtcatc
ctgaccccgcccgaggccccaaacctgaaatcggaagagctgaatgtggagccgggtttg
ggccggccgttacccccagaagtgaaagtggaagggcccaaggaagagttggaagttgtg
ggggagagagggtttgtgcaggaaaccaccaaggcagagccagaagtccttccacaggag
ggcgtcccagcccggctgcccgcggtcattatggacaccgcagggcaggcaggcggccct
gtggcttccagcccggaggtctcccagccgcagaaaggccggaagccccgggacctagag
cttccactcagcccgagcctgctgggtgggccgggacctgaacgaactccaggatcggga
actggctccggcctccaggctccggggccagcgctgaccccgtctctgcttcctacgcat
acattgaccccggtgctgctgacacccagctcactgcctcccagcattcacttctggagc
accctgagtcccattgcacctcggagcccagccaagctctctttccagtttccgtccagt
ggcagcgcccaggtgcacatcccttccatcagcgtggatggcctctcgacccccgtggtg
ctctccccagggccccagaagccatga

DBGET integrated database retrieval system