KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393852
Entry
100393852         CDS       T03264                                 

Gene name
NOTCH2
Definition
(RefSeq) notch 2
  KO
K20994  Notch 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04330  Notch signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04919  Thyroid hormone signaling pathway
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05206  MicroRNAs in cancer
cjc05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100393852 (NOTCH2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100393852 (NOTCH2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100393852 (NOTCH2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100393852 (NOTCH2)
   05206 MicroRNAs in cancer
    100393852 (NOTCH2)
  09162 Cancer: specific types
   05224 Breast cancer
    100393852 (NOTCH2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100393852 (NOTCH2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100393852 (NOTCH2)
SSDB
Motif
Pfam: EGF hEGF EGF_CA DUF3454 NOD Notch Ank_2 Ank EGF_2 Ank_5 NODP Ank_3 Ank_4 EGF_3 cEGF
Other DBs
NCBI-GeneID: 100393852
NCBI-ProteinID: XP_008982402
Ensembl: ENSCJAG00000019931
UniProt: A0A2R8N817
LinkDB
Position
18
AA seq 2470 aa
MPALRPAPLWALLALGLWCAAPARALQCRDGYEPCVNEGICVTYHNGTGYCKCPEGFLGE
YCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGT
CHMLSRDTYECTCQVGFTGKLCQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCE
TDVNECDIAGRCQHGGTCLNLPGSYQCQCPQGFTGQYCDSPYVPCAPSPCVNGGTCRQTG
DFTFECNCLPGFEGSTCEKNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCANRNGGFGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASF
SCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECA
MANSNPCEHAGKCVNTEGGFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTC
LCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGQVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICSPGYM
GTICSDQIDECYSNPCLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCTSNPCVHGICM
DGINHYSCVCSPGFTGQRCNIDIDECASNPCRKGATCVNGVNGFRCICPEGPHHPSCYSQ
VNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDDLVNGYR
CTCPKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPN
PCENAAVCKESPNFESYTCLCAPGWQGQQCTIDIDECISKPCMNHGLCHNTQGSYMCECP
PGFSGMDCEEDIDDCLANPCQNGGSCVDGVNTFSCICLPGFTEDKCQTDVNECLNEPCKN
GGTCSDYVNSYTCKCQAGFDGVHCENNIDECTESSCFNGGTCVDGVNSFSCLCPVGFTGP
FCLHEINECSSHPCLNEGTCVDGLGTYHCTCSLGYTGKNCQTLVNLCSQSPCKNKGTCVQ
EKAESRCLCPSGWAGAYCDVPNVSCDIAASSRGVPVEHLCQHSGVCINAGNTHYCQCPLG
YTGSYCEEQLNECASNPCHHGATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGSRGLLCEENIDDCAGGPHCLNGGQCVDRIGGYSCHCLPGFAGER
CEGDINECLSDPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFIDVCPQMPCLNGGTCA
VASNMPDGFICRCPPGFSGARCQSSCGQVKCKKGEQCVHTASGPRCFCPNPQDCESGCAS
SPCQHGGSCHPQRQPPFYSCQCTPPFWGSLCELYTVPPSTPPATCLSQYCADKARDGVCD
EACNSHACQWDGGDCSLTMENPWANCSSPLPCWDYINNQCDELCNTAECLFDNFECQGNS
KTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADQPENLAEGTLVIVVLLPPEQLLQ
DVRSFLRALGTLLHTNLRIKQDSKGEPMVYPYYGEKSAAMKKQRMTRRSLPGEQEQEVAG
SKVFLEIDNRQCVQDSDHCFKNTDAAAALLASHAIQGTLSYPLVSVISESPAPERTQLLY
LLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDASNHKRREPVGQDAVGLKNL
SVQVSEANLIGSGTSEHWVDDEGPQSKKVKAEDEALLSEEDNPIDRRPWTQQHLEAADIR
RTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDLSDEDEDAEDSSANIIT
DLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAA
DAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSA
LHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITD
HMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRSFLSLKHTPMG
KKSRRPSAKSTMPTSLPNLAKEAKEAKGSRRKKSVSEKVQLSESSVTLSPVDSLESPHTY
VSDTTSSPLITSPGILQASPNPMLATAAPPAPVHAQHALSFSNLHEIQPLAHGASTVLPS
VSQLLSHHHIVPPGSGSAGSLGRLHPVPVPADWMNRMEVNETQYNEMFGMVLAPAEGTHP
GIAPQSRPPEGKHITTPREPLPPIVTFQLIPKGSIAQPAGAPQPQSTCPPAVAGPLPTMY
QIPEMARLPSMAFPTAMMPQQDGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAER
TPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGQRGPGTHMSE
PPHNNMQVYA
NT seq 7413 nt   +upstreamnt  +downstreamnt
atgcccgccctgcgccccgcgccgctgtgggcgctgctggctctcgggctgtggtgcgcg
gcccccgcgcgtgcattgcagtgtcgagatggctacgaaccctgtgtaaatgaaggaata
tgtgttacctaccacaatggtacaggatactgcaaatgtccagagggcttcttgggagaa
tactgtcaacatcgagacccctgtgagaagaaccgctgccagaatggtgggacttgtgtg
gcccaggccatgctggggaaagctacgtgccgatgtgcctcagggttcacgggagaggac
tgccagtactcgacatctcacccctgctttgtgtctcgcccctgtctgaatggcggtaca
tgccatatgctcagccgggatacctatgagtgcacctgccaagttgggtttacaggtaaa
ctgtgccaatggactgatgcctgcctgtctcacccctgtgcaaatggaagcacctgtacc
actgtggccaaccagttctcctgcaagtgcctcacaggcttcacagggcagaagtgtgag
actgatgtcaatgagtgtgacattgcaggacgctgccagcatggtggcacctgcctcaac
ctgcctggttcctaccagtgccagtgccctcagggtttcacaggccagtactgtgatagc
ccttatgtgccctgtgcaccctccccttgtgtcaatggaggcacctgtcggcagactggt
gacttcacttttgaatgcaactgccttccaggttttgaagggagcacctgtgagaagaat
attgatgactgccctaaccataagtgtcagaatggaggggtttgtgtggacggggtcaac
acttacaactgccgttgtcctccacagtggacaggacagttctgcacagaggatgtggat
gaatgcctgctacagcccaacgcctgtcagaatggtggcacctgtgccaaccgcaatgga
ggctttggctgtgtatgtgtcaatggctggagtggagatgactgcagtgagaacattgat
gactgtgccttcgcctcctgtactccaggctctacctgcattgaccgtgtggcctccttc
tcttgcatgtgcccagaggggaaggcaggtctcctgtgtcatctggatgatgcatgcatc
agcaatccttgccacaagggggcactgtgtgacaccaaccccctgaatgggcagtatatt
tgcacctgcccgcaaggctacaaaggggctgactgcacagaagatgtggatgagtgtgcc
atggccaacagcaatccttgtgagcatgcaggaaaatgtgtgaacacagaaggtggcttc
cactgtgagtgtctgaagggttatgcagggcctcgctgtgagatggacatcaatgagtgc
cattccgacccttgccagaatgatgctacctgtttggataagattggaggcttcacatgc
ctgtgcatgccaggtttcaaaggtgtgcattgtgagttggaaataaatgaatgtcagagc
aacccttgtgtgaacaatgggcaatgtgtggataaagtcaatcgtttccagtgtctgtgt
cctcctggttttactgggcaagtttgccagatcgatattgatgactgttccagtactccg
tgtctgaatggggcaaagtgtattgatcacccgaatggctatgaatgccagtgtgccaca
ggtttcactggtgtgctgtgtgaggagaacattgacaactgtgaccccgatccgtgccac
cacggccagtgtcaggatggtattgattcctacacctgcatctgcagtcccgggtacatg
ggcaccatctgcagtgaccagattgacgaatgttacagcaacccttgcctgaacgacggg
cgctgcatcgacctggtcaatggctaccagtgcaactgccagccgggcacgtcgggcgtc
aattgtgaaattaactttgatgactgtacaagtaacccttgtgtccatggaatctgtatg
gatggcattaatcactacagctgtgtctgctctccagggttcacagggcagagatgtaac
attgacattgatgagtgtgcctccaacccctgtcggaagggtgcaacatgtgtcaatggt
gtgaatggtttccgctgtatatgcccggaggggccccatcaccccagctgctactcacag
gtgaatgaatgcctgagcaacccctgcatccatggaaactgtactggaggtctcagtgga
tataagtgcctctgtgatgcaggctgggttggcatcaactgtgaagtggacaaaaatgaa
tgcctttctaacccatgccagaatggaggaacttgtgatgatctggtgaacggataccgg
tgcacttgcccgaagggcttcaaaggctataactgccaggtgaatattgatgaatgtgcc
tcaaatccatgcctgaaccaaggaacctgctttgatgacataagtggctacacctgccac
tgtgtgctgccatacacaggcaagaattgtcaaacagtattggctccctgttccccaaat
ccttgtgagaacgctgctgtttgcaaagagtcaccaaattttgagagttacacctgcttg
tgtgctcctggctggcaaggtcagcagtgtaccattgacattgatgagtgtatctccaag
ccctgcatgaaccatggtctctgccataacacccagggtagctacatgtgtgaatgccca
ccaggcttcagtggtatggactgtgaggaggacatcgatgactgccttgccaatccttgc
cagaatggaggttcctgtgtggatggagtgaatactttctcctgcatctgccttccgggt
ttcaccgaggataagtgtcagacagacgtgaatgagtgtctgaatgaaccctgtaagaat
ggagggacctgctctgactacgtcaacagttacacttgcaagtgccaggcaggatttgat
ggagtccactgtgagaacaacatcgatgagtgcactgagagctcctgtttcaatggtggc
acatgtgttgatggggttaactccttctcttgcttgtgccctgtgggtttcactggaccc
ttctgcctccatgagatcaatgaatgcagctctcatccatgcctgaatgagggaacatgt
gttgatggcctgggtacctaccactgcacctgctccttgggctacactggaaaaaactgt
cagaccctggtgaacctctgcagtcagtctccatgtaaaaacaaaggtacttgcgttcag
gaaaaagcagagtcccggtgcctgtgtccatctggatgggctggtgcttattgtgacgtg
cccaatgtctcttgtgacatagcagcctccagcagaggtgtgcctgttgaacacttgtgc
cagcactcaggtgtctgcatcaatgctggcaacacgcattactgtcagtgtcccctgggc
tatactggcagctactgcgaggagcagctcaatgagtgtgcatccaacccctgccatcac
ggggcaacgtgcagtgacttcattggtggatacagatgtgagtgcgtcccaggctaccag
ggtgtcaactgtgagtatgaagtggatgagtgccagaatcagccctgccagaatggaggc
acctgtattgaccttgtgaaccatttcaagtgctcctgcccaccaggcagtcggggccta
ctctgtgaagaaaacattgatgactgtgccgggggtccccattgcctcaatggtggtcag
tgcgtggataggatcggaggctacagttgtcactgcttgcctggcttcgctggggaacgt
tgtgagggagacatcaacgagtgcctttctgacccctgcagctctgagggcagtctggac
tgtatccagcttaccaacgactacctgtgtgtttgtcgtagcgccttcaccggccggcac
tgtgaaaccttcatcgatgtgtgtccccagatgccctgcctgaatggagggacttgtgct
gtggccagcaacatgcctgatggtttcatttgccgttgtcccccgggattttccggggca
agatgccagagcagctgtggacaagtgaaatgtaagaaaggggagcagtgtgtgcacacc
gcctctggaccccgctgcttctgccccaacccccaggactgtgagtcaggctgtgccagt
agcccctgccagcacgggggcagctgccaccctcagcgccagcctcctttttactcctgc
cagtgcaccccaccattctggggcagcctctgtgaactctacacggtgcccccaagcacc
cctcctgccacctgtctgagccagtattgtgctgacaaagctcgggatggcgtctgcgat
gaggcctgcaacagccatgcctgccagtgggatgggggtgactgttctctcaccatggag
aacccctgggccaactgctcctccccgcttccctgctgggattatatcaacaaccagtgt
gacgagctgtgcaacacggccgagtgcctgtttgacaactttgaatgccaggggaacagc
aagacatgcaagtatgacaaatactgtgcagaccacttcaaagacaaccactgtgaccag
gggtgcaacagtgaggagtgtggctgggatgggctggattgtgctgctgaccagcctgag
aacctggcagagggtaccctggtgattgtggtgttgttgccacctgaacaactgctccag
gatgtccgcagcttcttgcgggcactgggcaccctgcttcacaccaacttgcgcattaag
caggactccaagggggaacctatggtgtacccctattatggtgagaagtcagctgccatg
aagaaacagaggatgacacgcaggtcccttcctggtgaacaagaacaggaggtggctggc
tctaaagtctttctggaaattgacaaccgccagtgtgttcaagactcagaccactgcttc
aagaacacagatgcagcagcagctctcctagcctctcacgccatacaggggaccctgtca
taccctctcgtgtctgtcatcagtgaatccccggctccagaacgcactcagctcctctat
cttcttgctgttgccgtggtcatcattctgtttattattctgctgggggtgatcatggca
aaacgaaagcgtaagcatggctctctgtggctgcctgaaggtttcactcttcgccgagat
gcaagcaatcacaagcgtcgtgagccagtgggacaggacgctgtggggctgaaaaatctc
tcagtgcaagtctctgaagctaacctaattggttctggaacaagtgaacactgggtcgat
gatgaagggccccagtcaaagaaagtgaaggctgaagatgaggccttgctctcagaagaa
gacaaccctatcgatcgacggccgtggacgcagcagcaccttgaagccgcagacatccgt
aggacaccatcgctggccctcacccctcctcaggcagagcaggaggtggatgtgttggac
gtgaatgtccggggcccagatggctgcaccccattgatgttggcttctctccgaggaggc
agctcagatttgagtgatgaagatgaagatgcagaggactcttctgctaacatcatcaca
gacttggtctaccagggtgccagccttcaggcccagacagaccggactggtgagatggcc
ctgcaccttgcagcccgctactcacgggctgatgccgccaagcgtctcctggatgcaggt
gcagatgccaatgcccaggacaacatgggccgctgccccctacatgctgcagtggcagct
gatgcccaaggtgtcttccagattctgattcgcaaccgagtaactgatctagatgccagg
atgaatgatggtactacacccctgatcctggctgcccgcctggctgtggagggaatggtg
gcagaactgatcaactgccaagcagatgtgaatgcagtggatgaccatggaaaatctgct
cttcactgggcagctgctgtcaataatgtggaggcgactcttttgcttttgaaaaatggg
gccaaccgagacatgcaggacaacaaggaagagacacctctgtttcttgctgcccgggag
gggagctacgaagcagccaagatcctgttagaccattttgccaatcgagacatcacagac
cacatggatcgtctgccccgcgatgtggctcgggaccgcatgcaccatgacatcgtgcgc
ctcctggatgagtacaatgtgaccccaagccctccaggcactgtgttgacttctgctctc
tcacctgtcatctgtgggcccaacagatctttcctcagcctgaagcacaccccaatgggc
aagaagtctagacggcccagtgccaagagtaccatgcccactagcctccctaaccttgcc
aaggaagccaaggaagccaagggtagtaggaggaagaagtctgtcagtgagaaggtccaa
ctctccgagagttctgtaactctatcccctgttgattccctagaatcgcctcacacatac
gtgtctgacaccacatcctctccactgattacatcccctgggatcttgcaggcttcaccc
aaccctatgttggccactgccgcccctcctgccccagtccatgcccagcatgcactgtct
ttttctaaccttcatgaaatacagcctttggcgcatggggccagcaccgtgcttccctca
gtgagccagttgctgtcccaccaccacattgtgcccccaggcagtggcagtgctggaagc
ttgggtaggctccatccagtcccagtcccagcagattggatgaaccgcatggaggtgaat
gagacccagtacaatgagatgtttggtatggtcctggctccagctgagggcacccaccct
ggcatagctccccagagcaggccacctgaagggaagcacataaccacccctcgggagccc
ttgccccccattgtgactttccagctcatccctaaaggcagtattgcccagccagcgggg
gctccccagcctcagtccacctgccctccagctgttgcaggtcccctgcccaccatgtac
cagattccagaaatggcccgtttgcccagtatggctttccctactgccatgatgccccag
caggatgggcaggtagctcagaccattctcccagcctatcatcctttcccagcctctgtg
ggcaagtaccccacacccccttcacagcacagttatgcttcctcaaatgctgctgagcga
acacccagtcacagtggtcacctccagggtgagcatccctacctgacaccatccccagag
tctcccgaccagtggtcaagttcatcaccccactctgcttctgactggtcagatgtgacc
accagccctacccctgggggtgctggaggtcagcggggacctgggacacatatgtctgag
ccaccacacaacaacatgcaggtttatgcgtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100408994
Entry
100408994         CDS       T03264                                 

Gene name
NOTCH3
Definition
(RefSeq) notch 3
  KO
K20995  Notch 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04330  Notch signaling pathway
cjc04371  Apelin signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04919  Thyroid hormone signaling pathway
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05206  MicroRNAs in cancer
cjc05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100408994 (NOTCH3)
   04371 Apelin signaling pathway
    100408994 (NOTCH3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100408994 (NOTCH3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100408994 (NOTCH3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100408994 (NOTCH3)
   05206 MicroRNAs in cancer
    100408994 (NOTCH3)
  09162 Cancer: specific types
   05224 Breast cancer
    100408994 (NOTCH3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100408994 (NOTCH3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100408994 (NOTCH3)
SSDB
Motif
Pfam: EGF hEGF EGF_CA Notch EGF_2 Ank Ank_2 NODP Ank_5 NOD DUF3454 Ank_3 Ank_4 cEGF EGF_3
Other DBs
NCBI-GeneID: 100408994
NCBI-ProteinID: XP_017822783
Ensembl: ENSCJAG00000002121
LinkDB
Position
22
AA seq 2364 aa
MGPGARGRCRRPMSPPLPPLPVRALPLLLLLAGPGAAGPPCLDGSPCANGGRCTQLPSQE
AACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDP
CLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCRSDVDECRVGGPCRHGGTCLNTPGSFR
CQCPAGYTGSLCENTIVPCAPSLCRNGGTCRQSGDFTYDCACLPGFEGQNCEVNVDDCPG
HQCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSCVC
VNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPCHE
DAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCGRG
YTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPCVNGG
VCKDRVNGFTCTCPSGFSGSTCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEGTLC
ERNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLDLVD
KYLCRCPSGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEINECA
SSPCGEGGSCVDGENGFRCLCPPGSLPPLCLPPSHPCAHEPCNHGICYDAPGGFRCVCEP
GWSGPRCSQSLARDACESQPCRAGGTCSSDGAGFHCTCPPGFQGRQCELLSPCTPNPCEH
GGRCESAPGQLAVCSCPQGWQGSRCQQDVDECASPSPCGPHGICTNLAGGFSCTCHGGYT
GPSCDQNINDCDPNPCLNGGLCQDGVGSFSCSCLPGFAGPRCAHDVDECLSSPCGPGTCT
DHVASFTCTCPPGYGGFHCEQDLPDCSPSSCFNGGTCVDGVNSFSCLCRPGYTGAHCQHE
ADPCLSRPCLHGGICSAAHPGFRCTCPESFTGPQCQKLVDWCSREPCQNGGRCVQTGAYC
LCPPGWSGRLCDIRSLPCREAAAQIGVQPEQLCQAGGQCVDEDSSHYCVCPEGHTGSHCE
LEVDPCLAQPCQHGGTCRGYMGGYVCECLPGYNGDNCEDDVDECASQPCQHGGSCIDLVA
RYLCSCPPGTLGVLCEINEDDCGPGPLLDSGPRCLHNGTCVDLVGGFRCTCPPGYTGLRC
EADINECRSGACHAAHTRDCLQDAGGGFRCLCHAGFSGPRCQTVLSPCESQPCQHGGQCR
PSPGPGGGLTFTCHCVQVGMGVGLWRRSGGVASRRRMWLYSPLFRFFYSSLTFFPVSPNP
TPSLFGHRCERVARSCRELQCPVGXPCQQTPRGPRCAAPPGLSGSSCRSFSGSPLGATNA
SCAAAPCLHGGSCRPAPLRPFFRCACTPGWTGPRCEAPAAAPEVPEEPRCPRVACQAKRG
DQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFD
CHTGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTV
LLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHRPSPDSELRARRELAPEV
IGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRGEPLEPP
EPSVPLLPLLAAGAVLLLVILVLGVMVARRKREHSTLWFPEGFALHKDVATGHKGRREPV
GQDALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPGMGAEEAVDCRQWTQHHLVA
ADIRMAPAMALTPPQGDADADGMDVNVRGPDGFTPLMLASFCGGALEPMPIEEDEADDTS
ASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRLLDAGADTNAQDHSGRTPLH
TAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVEGMVEELIASHADVNAVDE
LGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLAAREGSYEAAKLLLDHFAN
REITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPPGPHGLGPLLCPPGAFLPGLKAAQ
SGAKKSRRPAGKAGLGPQGPRGRGKKLTLACPGPLADSSVTLSPVDSLDSPRPFGGPPAS
PGGFPLEGPYAAAAATAVSLAQLGGPGRAGLGRQPPGGCVLSLGLLNPVAVPLDWARLPP
PAPPGPSFLLPLAPGPQLLNPGTPVSPQERPPPYLAVPGHGEEYPAAGAHSSPPKARFLR
VPSEHPYLTPSPESPDHWASPSPPSLSDWSESTPSPATATGAMATTTGALPSQPLPLSVP
SSLAQAQTQLGPQPEVTPKRQVLA
NT seq 7095 nt   +upstreamnt  +downstreamnt
atggggccgggggcccggggccgctgccgccgcccgatgtcgccgccactgccaccgcta
cccgtgcgggcgttgcccctgctgctgctgctagcggggccgggggctgcaggcccccct
tgcctggacggaagcccgtgtgcaaatggaggtcgttgcacccagctgccctcccaggag
gctgcctgcctgtgcccgcccggctgggtgggcgagcggtgtcagctggaggacccctgt
cactcaggcccctgtgctggtcgtggtgtctgccagagttcagtggtggctggcactgcc
cgattctcatgccggtgcccccgtggcttccgaggccccgactgctccctgccagatccc
tgcctcagcagcccttgtgcacatggtgcccgctgttcagtggggcccgatggacgcttc
ctctgctcctgcccacctgggtaccagggccgcagctgccgaagcgatgtggatgagtgc
cgggtgggtgggccctgccgccatggtggcacctgcctcaacacacctggctccttccgc
tgccagtgtccagctggctacaccgggtcactatgtgagaacactatagtgccctgtgcg
ccctcgctatgccgtaacgggggcacctgcaggcagagtggtgacttcacttatgactgt
gcctgtcttcctgggtttgagggtcagaattgtgaagtgaacgtggacgactgtccaggg
caccaatgtctcaacggggggacatgtgtggatggcgtcaacacctacaactgccagtgc
cctcctgagtggacaggccagttctgcacggaggacgtggacgaatgtcagctgcagccc
aacgcctgccacaatgggggcacctgcttcaatacactgggtggccacagctgcgtgtgt
gtcaatggctggacaggcgagagctgcagtcagaatatcgatgactgtgccacagctgtg
tgcttccacggggccacctgccatgaccgcgtggcttctttctactgtgcctgccccatg
ggcaagactggcctcctgtgtcacctggatgacgcctgtgtcagcaacccctgtcatgag
gatgctatctgtgacacgaatccggtgaacgggcgggcgatttgcacctgtccgcccggc
ttcacgggcggggcatgtgaccaggatgtggacgagtgctctattggcgccaacccctgt
gagcacttgggcaggtgcgtgaacacgcagggctccttcctgtgccagtgtggccgtggc
tacaccggacctcgctgtgagaccgatgtcaacgagtgtctgtcggggccctgccgcaac
caggccacgtgcctcgaccgcatcggccagttcacctgtatctgtatggcaggcttcaca
ggaacctattgcgaggtggacatcgacgagtgtcagagtagcccctgtgtcaatggtggg
gtctgcaaggaccgagtcaacggcttcacctgcacctgcccatcgggcttcagcggctcc
acgtgtcagctggacgtggacgaatgcgcaagcacgccctgcaggaatggcgccaagtgc
gtggaccagcctgatggctacgagtgtcgctgtgccgagggctttgaggggacgctgtgt
gaacgcaacgtggatgactgctcccctgatccgtgccaccatggtcgctgcgtggatggc
atcgccagcttctcatgtgcctgtgcccccggctacacgggcacacgctgcgagagccag
gtggatgagtgccgcagccagccctgccgccatgggggcaaatgcctagacctggtggac
aagtatctctgccgctgcccttctgggaccacaggtgtgaactgtgaagtgaacattgac
gactgtgccagtaacccctgcacctttggagtctgccgtgatggtatcaaccgctacgac
tgtgtctgccagcctggcttcacagggcccctttgtaacgtggagatcaatgagtgtgct
tccagcccctgcggcgagggaggttcctgcgtggatggggaaaacggcttccgctgcctc
tgcccgcccggctccttgcccccactctgcctccccccgagccatccctgtgcccatgag
ccctgcaatcacggcatctgctatgatgcacctggcgggttccgatgtgtatgtgagcct
ggctggagtggcccccgctgcagccagagcctggcccgagatgcctgtgagtcccagccc
tgccgggccggcgggacctgcagcagcgatggagcgggcttccactgcacctgtcctcct
ggttttcagggacgtcaatgtgagctcctctccccctgcaccccaaacccctgtgagcat
gggggccgctgtgagtctgcccctggccagctggctgtctgctcctgcccccagggatgg
caaggttcacgatgccagcaggatgtggacgagtgtgctagcccctcaccctgcggccct
catggtatctgcaccaacctggcagggggtttcagctgcacctgccatggagggtacact
ggcccttcctgtgatcagaacatcaatgactgtgaccccaacccatgcctgaacggaggc
ttgtgccaagacggcgtgggttccttttcgtgctcctgcctccctggttttgccggccca
cgttgcgcccacgacgtggatgagtgcctcagcagcccttgcggcccgggtacctgcact
gaccacgtggcctccttcacctgcacctgcccacctggctacggaggcttccactgcgag
caggacctgccagactgcagccccagctcctgcttcaatggcgggacctgtgtggacggc
gtgaactcgttcagctgcctgtgccgtcccggctacacaggagcccactgccaacacgag
gcagatccctgcctttcgcggccctgcctgcacgggggcatctgcagcgccgcccatcct
ggcttccgctgcacctgccccgagagcttcacgggcccccagtgccagaagctggtggac
tggtgcagccgggagccttgtcaaaacgggggtcgctgtgtccagactggggcctattgc
ctttgtcccccaggatggagtggccgcctctgtgacattcgaagcctgccctgcagggag
gccgcagcccagatcggggtgcagccagagcagctctgtcaggcgggtgggcagtgtgta
gatgaagacagctcccactactgcgtgtgcccagaaggccatactggtagccactgtgag
ctggaggtggacccctgcttggcccagccctgccagcatggggggacctgccgtggctac
atggggggctatgtgtgtgagtgtctgcctggctacaatggtgacaactgtgaggacgac
gtagacgagtgtgcctcccagccctgccagcacgggggctcctgcattgaccttgtggcc
cgatatctctgctcttgtcccccaggaacgctgggcgtgctctgtgagattaatgaggat
gactgcggcccaggtccactcctggactcagggccccggtgcctacacaatggcacctgc
gtggacctggtgggtggcttccgctgcacctgtcccccaggatacaccggtttgcgctgt
gaggcagacatcaatgagtgtcgctcaggtgcctgccacgcggcacacacccgggactgc
ctgcaggacgcaggagggggtttccgttgtctttgccatgctggcttctcaggtccccgc
tgtcagactgtcttgtctccctgtgagtcccagccatgccagcatggaggccagtgccgt
cctagcccgggtcctgggggtgggttgaccttcacctgccactgtgtccaggtcggtatg
ggtgtgggcctctggaggaggagtgggggagtggcctctaggaggaggatgtggctttat
tccccactcttccgtttcttctactcctccctcactttttttcctgtctccccaaacccg
acccccagccttttcgggcacaggtgcgagcgggtggcgcgctcctgccgggagctgcag
tgcccggtgggcngtccatgccagcagacaccccgcgggccgcgctgcgctgccccccca
gggttgtcggggtcctcctgccgcagcttctcggggtcgccgctgggggccaccaacgcc
agctgcgcagccgccccctgtctccacgggggctcctgccgccccgcgccactcagaccc
ttcttccgctgcgcttgcacgccgggctggaccggaccgcgctgcgaggcacccgccgcg
gcacccgaggtcccggaggagccgcggtgcccacgcgtcgcctgccaggccaagcgcggg
gaccagcgctgcgatcgcgagtgcaacagccctggctgcggctgggacggcggcgactgc
tcgctgagcgtgggcgacccctggcggcagtgcgaggcgctgcagtgctggcgcctcttc
aacaacagccgctgcgaccctgcctgcagctcgcccgcctgcctctacgacaacttcgac
tgccacactggtggccgcgagcgcacttgcaacccggtatacgagaagtactgcgctgac
cactttgctgacggccgctgcgaccagggctgcaacacggaggagtgcggctgggatgga
ctggattgtgccagcgaggtgccggccctgttggcccgtggcgtgctggtgctcacagtg
ctgctgccaccggaggagctgctgcgttccagcgctgactttctgcagcggctcagcgcc
atcctgcgcacctcgctgcgcttccgcctggacgcgcacggccaggccatggtctttcct
taccaccggcccagtcctgactctgaactccgggcccgtcgggagctggcccccgaggtg
atcggctctgtagtgatgctggagattgacaaccggctctgcctgcagtcccctgagaat
gatcactgcttccccgacgcccagagcgccgctgactacctgggagcgctgtcagcggtg
gagcgcctggacttcccgtacccactgcgggacgtgcggggggagcctctggagcctcca
gagcccagcgtcccgctgctgccactgctggcagccggcgccgtcttgctgctggtcatc
ctcgtcctgggcgtcatggtggcccggcgcaagcgtgagcacagcaccctctggttcccc
gagggcttcgcactgcacaaggacgtggccactggtcacaagggccggcgggaacccgtg
ggccaagatgcactgggcatgaagaacatggccaagggtgaaagtctgatgggggaagtg
gccacagactggatggacacagagtgcccagaggccaagcggctgaaggtagaggagcca
ggcatgggggctgaggaggctgtggattgccgtcagtggactcaacaccatctggttgct
gctgacatacgcatggcaccagccatggcactgacaccaccacagggcgacgcagatgct
gatggcatggatgtcaatgtgcgtggcccagatggcttcaccccattaatgctggcttcc
ttctgtgggggggccttggagccaatgccaattgaggaggatgaggcagatgacacatca
gccagcatcatctcagacctgatctgccagggggctcagcttggagcacggactgaccgt
actggcgagactgcattgcacctggctgcccgttatgcccgtgctgatgcggctaagcgg
ctgctggatgctggggcagacaccaatgcccaggaccactcgggccgaactcctctgcac
acagctgtcacagctgatgcccagggtgtcttccagattctcatccgaaatcgctctaca
gacttggatgctcgcatggcggatggttcaacggcactgattctggcagcccgcctggca
gtggagggcatggtggaagagctcattgccagccatgctgatgtcaatgctgtggatgag
cttgggaaatcagccttacactgggctgcggctgtgaacaacgtggaagccactttggcc
ctgctcaaaaatggcgccaacaaagacatgcaggatagcaaggaggagacgcccctgttc
ctggccgcccgcgagggcagctacgaggctgccaagctgctgttggaccacttcgccaac
cgcgagatcactgaccacctagacaggctgccacgggacgtagcccaggagcgactgcac
caggacatcgtgcgcttgctggatcaacccagtgggccccgcagccccccgggaccccac
ggcctggggcctctgctctgccctccaggggccttcctcccgggcctcaaggcggcacag
tcaggggccaagaagagcaggaggccggctgggaaggcaggcctggggccacagggaccc
cgggggcgaggcaagaagctgacgctggcctgcccgggccccctggccgacagctcggtc
acactgtcacctgtagactcgctggactccccgcggcctttcggggggccccctgcttcc
cctggtggcttcccccttgaggggccctatgcagctgccgctgccactgcagtgtctctt
gcgcagcttggtggcccaggccgtgcgggtctaggacgccagccccctggaggatgtgtg
ctcagcctgggcctgctgaaccccgtggccgtccccctcgattgggcccggctgccccca
cctgcccccccaggcccctcattcctgctgccactggcgccgggaccccagctgctcaac
ccaggtacccctgtctcaccgcaggagcggcccccaccttacctggcagtcccaggacac
ggcgaggagtacccggcggctggggcacacagcagccccccaaaggcccgcttcctgcgg
gtgcccagcgagcacccttaccttaccccatccccagaatcccctgaccactgggccagc
ccctcgcctccctccctctcggactggtccgaatccacacccagcccagccactgccacc
ggggccatggccaccaccacaggggcactgccttcccagccactccccttgtctgttccc
agctcccttgctcaggcccagacccagctggggccccagccggaagtcacccccaagagg
caagtgttggcctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 103795708
Entry
103795708         CDS       T03264                                 

Gene name
NOTCH1
Definition
(RefSeq) notch 1
  KO
K02599  Notch 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04330  Notch signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04919  Thyroid hormone signaling pathway
cjc05020  Prion disease
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05206  MicroRNAs in cancer
cjc05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103795708 (NOTCH1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103795708 (NOTCH1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103795708 (NOTCH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103795708 (NOTCH1)
   05206 MicroRNAs in cancer
    103795708 (NOTCH1)
  09162 Cancer: specific types
   05224 Breast cancer
    103795708 (NOTCH1)
  09164 Neurodegenerative disease
   05020 Prion disease
    103795708 (NOTCH1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103795708 (NOTCH1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103795708 (NOTCH1)
SSDB
Motif
Pfam: EGF hEGF EGF_CA Ank_2 NOD Notch Ank DUF3454 NODP EGF_2 Ank_5 Ank_4 Ank_3 EGF_3
Other DBs
NCBI-GeneID: 103795708
NCBI-ProteinID: XP_017819161
LinkDB
Position
1
AA seq 2555 aa
MAGSVKRPNGTEACVCGGAFVGLRCQDSNPCLSTPCKNAGTCHVVDRGGMADYVCSCPLG
FSGPLCLTPLDNACLSNPCRNGGTCDLLTLTEYKCRCPPGWSGKLCQQADPCASNPCANG
GQCLPFDASYICHCPPSFHGPTCRQDVNECSQNPGPCRHGGTCHNEVGSYHCTCRATHTG
PNCERPYVPCSPSPCQNGGTCRPTGDTTHECACLPGFTGQNCEENIDDCPENKCKNGGTC
VDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDC
SENIDDCASAACFHGATCHDRVASFYCECPHGRTGLLCHLNDACISNPCNEGSNCDTNPV
NGKAICTCPSGYTGPACSQDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEID
VNECVSNPCQNDATCLDQIGEFQCICMPGYEGMHCEVNTDECASSPCLHSGRCLDKINEF
QCECLMGFTGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDP
DPCHYGTCKDGVSTFTCLCRPGYTGHHCETNINECSSQPCRHGGTCQDRDNAYLCFCLKG
TTGPNCEINLDDCASSPCDSXTCLDKIDGYECACEPGYTGSMCNIDIDECAGSPCHNGGT
CEDGVNSFTCRCPEGYHDPTCLSEVNECNSNPCVHGACRDSLNGYAQGPVIGTSPEPWEL
CHQEGRDGPETGFGRGQAAGSTPRGRPHLWALRRPAVHTWQLCGCMVGSGHRPKVTLETR
LHGDSGECESNPCVNGGTCRDMTGGYVCTCREGFQRXCCPFPPGPNCQTNINECASNPCL
NQGTCIDDIAGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRESEDYESFSCVCPTGW
QGQTCEVDINECVKSPCQHGASCQNTQGSYRCHCQAGYSGRNCETDIDDCRPNPCHNGGS
CTDGVNMAFCDCLPGFQGTFCEEDINECASDPCRNGANCTDCVDSYTCTCPAGFSGIHCE
NNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTCQDSCG
SYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVSC
EVAAQRQGVDIAHLCQHGGLCVDTGNTHHCRCQAGYMGSYCEDLVDECSPSPCQNGATCT
DYLGGYSCKVGAPIVEWGLWPVVLPHTSQNGGTCLDLPNTYKCSCPRGTQGVHCEINVDD
CNPAMDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFVGERCEGDVNECLSNPCDARGTQNC
VQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNGGTCAVASNTARGFICKCPSGFEGAT
CENDARACGQPCAAFNGGTCISGPRSPTCLCLGPFTGPECQFPTSSPCLGGNPCYNQGTC
EPTSEXPFYRCLCPAKFNGLLCHILDYSFGGGAGRDIPPPQIEEACELPECREDSGNKAC
SLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGRCDSQCNSAGCLFDGFDCQR
VEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPE
QLRNSSFHFLRELSRVLHTNVVFKRDANGQQMIFPYYGREEELRKHPIKRAAEGWAAPGS
LLGQVKASLLPGGRRRRELDPMDIRGSIVYLEIDNRQCVQASSQCFQSATDVAAFLGALA
SLGSLNIPYKIEAVQSETVEPPPPAQLHFMYVAAAAFVLLFFVGCGVLLSRKRRRQHGQL
WFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASDGALMDVLGGGATPWPLQLGAAAPLP
WAAAGHRPSRLNTIASAPADGFTPLMIASCSGGGLEMGNSEEEEDAPAVISDFIYQGASL
HNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQIL
IRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNN
VDAAVVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDI
AQERMHHDIVRLLDEYNLVRSPQLHGAPLGGTPTLSPPLCSPNGYLGSLKPGVQGKKVRK
PSSKGLACSGKETKDLKVRRKKSQDGKGCLLDNSGMLSPVDSLESPHGYLSDVASPPLLP
SPFQQSPSMPLTHLPGMPDTHLGIGHLNVAAKPEIAALGGGGQLAFEAGPPRLSHLPVAS
GTSTVLGSSSGGAVNFTVGGSTGLNGQCEWLSRLQSRLVPSQYNPLRGGVVPGPLSSQAP
SLQHSMVGPLHSGLAASTVPQMMSYQGLPSTRLATQPHLVQTQQVQPQNLQMQPQNLQPP
NIQQQQSLQPPLPPQPHLSVSSSASGHLGRSFLSGEPSQADVQPLGPSSLAPHTILPQES
PALPTSLPSSLVPPVTAAQFLTPPSQHSYSSSPVDNTPSHQLQVPEHPFLTPSPESPDPW
SSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK
NT seq 7668 nt   +upstreamnt  +downstreamnt
atggcgggaagtgtgaagcggcccaatggcacggaggcctgcgtctgcggcggcgccttt
gtgggcctgcgatgccaggactccaacccgtgtctcagcaccccatgcaagaacgctgga
acctgccacgtggtggaccgtggaggcatggcggactatgtctgcagctgccccctgggt
ttctccgggcccctctgcctgacacccctggacaatgcctgcctctccaacccctgccgc
aacgggggcacctgcgacctgctcacgctcacggagtacaagtgccgctgcccacctggc
tggtcagggaaattgtgccagcaggctgacccgtgcgcctccaacccctgcgccaatggc
ggccagtgcctgcccttcgatgcctcctacatctgccactgcccacccagcttccatggc
cccacctgccggcaggacgtcaacgagtgcagccagaaccctgggccctgccgccatgga
ggaacctgccacaacgaggtcggctcctaccactgcacctgccgagccacgcacaccggc
cccaactgtgagcggccctacgtgccctgcagcccctcgccctgccagaatgggggcacc
tgtcgccccacgggcgacaccacacacgagtgcgcctgtctgccaggcttcaccggccag
aactgtgaggagaatatcgacgactgtccagaaaacaagtgcaagaatgggggcacctgt
gtggacggcgtgaacacctacaactgccgctgcccgccagagtggacaggtcagtactgc
accgaggatgtggacgagtgccagctcatgccaaatgcctgccagaacggcgggacctgc
cacaacacccacggtggctacaactgtgtgtgcgtcaatggctggactggcgaggactgt
agcgagaacatcgatgactgcgccagcgccgcctgcttccacggcgccacctgccatgac
cgcgtggcctccttctactgcgagtgtccccacggccgcacaggtttgctgtgccacctc
aacgacgcgtgcatcagcaacccctgcaacgagggctccaactgcgataccaaccccgtc
aacggcaaagccatctgcacctgcccctcggggtacacgggtccggcctgcagccaggac
gtggacgaatgctcgctgggtgccaacccctgcgagcatgcgggcaaatgcatcaacact
ctgggctccttcgagtgccagtgtctgcagggctacacgggcccccgctgcgagattgac
gtgaacgaatgcgtctcgaacccgtgccagaacgacgccacctgcctggaccagatcggg
gagttccagtgcatctgcatgcccggctacgagggcatgcactgtgaagttaacacggat
gagtgcgccagtagcccctgcctgcacagcggccgctgcctggacaagatcaatgagttc
cagtgcgagtgtctcatgggcttcactgggcacctgtgccagtacgatgtggacgagtgt
gccagtaccccctgcaagaatggcgccaagtgcctggatggacccaacacttacacctgc
gtgtgcacagaagggtacacggggacgcactgcgaggtagacattgatgagtgtgatccc
gacccctgtcactacggcacctgcaaggacggcgtctccaccttcacctgcctctgccgc
ccgggctacacgggccaccactgcgagaccaacattaacgagtgctccagccagccctgc
cgccacgggggcacctgccaggaccgcgacaacgcctacctctgcttctgcctgaagggg
accacaggacccaactgcgagatcaacctggatgactgtgccagcagcccctgtgactca
ngcacctgtctggacaagattgatggctacgagtgtgcctgtgaaccaggctacacaggg
agcatgtgcaacatcgacattgatgagtgtgcgggcagcccctgccacaatggcggcaca
tgcgaggacggcgtcaacagcttcacctgccgctgtcccgagggctaccacgaccccacc
tgcctgtccgaggtcaacgagtgcaacagcaacccctgtgtccacggggcctgccgggac
agcctcaacgggtacgcccaggggccggtaatagggaccagccctgaaccctgggagctc
tgccaccaggagggtcgggatgggccggaaacaggctttggacggggccaggcggcaggg
agcacccctcggggacgcccacacctatgggccctcagacggccagcagtccacacctgg
cagctctgtggctgcatggtgggctcaggacacaggcccaaagtgaccctggaaacacgt
ttgcatggtgacagcggcgagtgtgagtccaacccttgcgtcaacggtggcacctgcaga
gacatgaccggcggctacgtgtgcacatgccgggagggctttcagcggtgatgctgtccc
ttccctccaggccccaactgccagaccaacatcaatgagtgtgcgtccaacccgtgtctg
aaccagggcacgtgtattgatgatattgccgggtacaagtgcaactgcctgctgccctac
acaggtgccacgtgtgaggtggtgctggccccgtgcgcccccagcccctgcagaaatggc
ggggagtgcagggaatctgaggactacgagagcttctcctgcgtctgccccacgggctgg
caaggacagacctgtgaggtagacatcaacgagtgtgtgaagagcccgtgccagcacggg
gcgtcctgccagaacacccagggcagttaccgatgccactgccaggctggctacagcggg
cgcaactgcgagacagacattgacgactgtcggcccaacccgtgtcacaacggcggctcc
tgcacagacggtgtcaacatggccttctgcgactgcctgcccggcttccagggcactttc
tgtgaggaggacatcaacgagtgtgccagtgacccctgccgcaacggggccaactgcaca
gactgtgtggacagctacacgtgcacctgccccgcgggcttcagtgggatccactgtgag
aacaacacgcctgactgcacggagagctcctgcttcaatggtggcacctgtgtggacggc
atcaactccttcacttgcctgtgcccacccggcttcacgggcagctactgccagcacgac
gtcaacgaatgcgactcacaaccctgcctgcatggtggcacctgccaggacagctgtggc
tcctacaggtgcacctgcccccagggctacactggccccaactgccagaacctcgtgcat
tggtgtgactcctcaccctgcaagaacgggggcaaatgctggcagacccacacccagtac
cgctgcgagtgtcccagtggctggaccggcctgtactgtgacgtacccagcgtctcctgt
gaggtggccgcccagcggcaaggtgttgacattgcccatctgtgccagcacggggggctg
tgtgtggacaccggcaacacgcaccactgccgctgccaggcgggctacatgggcagctac
tgtgaggacctggtagacgagtgctcgcccagcccctgccagaatggggccacctgcacc
gactacctgggcggctactcctgcaaggtgggggcccccattgtagagtgggggttgtgg
ccggttgtgttgccacacaccagccagaacgggggcacctgcctcgacctccccaacacc
tacaagtgctcctgcccacggggcacgcagggtgtgcactgcgagatcaacgtggacgac
tgcaaccccgccatggaccccgtgtcccggagccctaagtgctttaacaacggcacctgt
gtggaccaggtgggcggctacagctgcacctgcccaccgggcttcgtgggtgagcgctgt
gagggggacgtcaacgagtgcctctccaatccctgtgacgcccgcggcacccagaactgc
gtgcagcgcgtcaatgacttccactgcgagtgccgtgccggtcacaccgggcgccgctgt
gagtcagtcatcaatggctgcaagggcaagccctgcaagaacgggggaacttgtgccgtg
gcctccaacactgcccgcgggttcatctgcaagtgcccttcgggcttcgagggcgccacg
tgtgagaacgacgcacgtgcctgtgggcagccttgcgctgccttcaatggtggcacctgc
atctccggcccacgcagccccacctgcctgtgcctggggcccttcacgggccccgagtgc
cagtttcccaccagcagcccctgcctgggtggcaacccctgctacaaccagggcacctgt
gagcctacatccgagnagcccttctaccgctgcctgtgccctgccaaattcaacgggctc
ctgtgccacatcctggactacagctttgggggtggggccgggcgcgacatccccccgccg
cagatcgaggaggcatgtgaactgcctgagtgccgggaggactcgggcaacaaggcctgc
agcctgcagtgcaataaccacgcgtgtggctgggatggcggcgactgctctctcaacttc
aacgacccctggaagaactgcacgcagtctctgcagtgctggaaatatttcagcgacggc
cgctgtgacagccagtgcaactcggccggctgcctcttcgacggcttcgactgccagcgc
gtggaaggccagtgcaatcccctgtacgaccagtactgcaaggaccacttcagcgacggg
cactgcgaccagggctgcaacagcgcggagtgcgagtgggacgggctggactgtgcagag
catgtgcccgagaggctggcggccggcacgctggtggtggtggtgctgatgccgccagag
cagctgcgcaacagctccttccacttcttgcgcgagctcagccgcgtgctgcacaccaac
gtggtcttcaagcgcgacgcaaacggccagcagatgatcttcccctactacggccgcgag
gaggagctgcgcaagcatccaatcaagcgtgctgccgagggctgggccgcacccggctcc
ctgctgggccaggtgaaggcctcgctgctccctggtgggcggcggcggagggagctggac
cccatggacatccgcggctccatcgtctacctggagattgacaaccggcagtgtgtgcag
gcctcctcgcagtgcttccagagcgccaccgacgtggctgcgttcctgggggcgctcgcc
tcactaggcagcctcaacatcccctacaagatcgaggctgtgcagagtgagaccgtggag
ccgcccccgccggcgcagctgcacttcatgtacgtggcggcggccgcctttgtgctcctc
ttcttcgtgggctgtggggtgctgctgtcccgcaagcgccggcggcaacatggccagctc
tggttccccgagggcttcaaggtgtccgaggccagcaagaagaagcggcgggagcccctt
ggcgaggactccgtgggcctcaagcccctgaagaacgcctcagacggtgccctcatggat
gtgctgggtggtggggccacaccgtggcccctccagctgggggctgctgcccccctcccc
tgggctgcagctgggcaccggccctccagactgaacaccatcgcctctgcccctgcagac
ggcttcaccccactcatgatcgcctcctgcagtggaggcggcctagagatgggcaacagt
gaggaggaggaggatgcgccagccgtcatctccgacttcatctaccagggcgccagcctg
cacaaccagacagaccgcacaggcgaaactgccttgcacctggctgcccgctactcacgc
tctgacgccgccaagcgcctgctggaggccagtgcggacgccaacatccaggacaacatg
ggccgcaccccgctgcatgcggccgtgtctgccgacgcccaaggcgtcttccagatccta
atccggaaccgagccacagacctggacgcccgcatgcacgatggcacgacaccgctgatc
ctggctgcccgcctggccgtggagggcatgctggaggacctcatcaactcgcacgctgac
gtcaacgccgtagatgacctgggcaagtccgccctgcactgggctgccgctgtgaacaat
gtggatgccgcagtggtgctcctgaagaatggggccaacaaggacatgcagaacaacaag
gaggagacgcccctgtttctggctgcccgggaaggcagctatgagaccgccaaggtgctg
ctggaccactttgccaaccgagacatcacagaccacatggaccgcctgccacgggacatc
gcgcaggagcgcatgcaccatgacattgtgagactgctggacgagtacaacctggtgcgc
agcccgcagctacacggagccccgctggggggcactcccaccctgtcgcccccgctctgc
tcgcccaatggctacctgggcagcctcaagcctggcgtgcagggcaagaaggtccgcaag
cccagcagcaaaggcctggcctgcagcggcaaagagaccaaggacctcaaggtgcggagg
aagaagtcccaggacggcaagggctgcctgctggacaactccggcatgctctcacctgtg
gactccctggagtcaccccacggctacctgtcagatgtggcctcaccgccactgctgccc
tccccattccagcagtctccatccatgcccctcacccacctccccggcatgcctgacacc
cacctgggcatcgggcacctgaacgtggcagccaagcccgagatagcggcgctgggcggg
ggtggccagctggccttcgaagccggccccccacgtctctcccacctgcctgtggcctcc
ggcaccagcaccgtgctgggctccagcagcggaggggccgtgaatttcactgtgggcggg
tccaccggtttgaatggtcagtgtgagtggctgtcccggctgcagagccgcttggtgccg
agccagtacaacccgctgcgggggggcgtggtcccaggccccctgagctcgcaggccccc
tctctgcagcacagcatggtgggccctctgcacagcggccttgctgccagcaccgtgccc
cagatgatgagctaccagggcctgcccagcacccggctggccacccagcctcacctggtg
cagacccagcaggtgcagccccagaacttacagatgcagccacagaacctgcagccacca
aacatccagcaacagcaaagcctgcagccaccgctgccaccacagccacacctcagcgtg
agctcctcggccagcggccacctggggcggagcttcctgagtggagagccgagccaggcg
gacgtgcagccactgggccccagcagcctggccccgcacaccatcctgccccaggagagc
cccgccctgcccacgtcgctgccgtcctcgctggtcccacctgtgactgcggcccagttc
ctgacgcccccctcacagcacagctactcctcctcccccgtggacaacacccccagccac
cagctgcaggtgcccgagcaccccttcctcaccccatctcccgagtcccccgacccgtgg
tccagctcatccccgcattccaacgtctctgactggtctgagggcgtctccagcccgccc
accagcatgcagtctcagattgcccgcattccggaggccttcaagtaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 108587674
Entry
108587674         CDS       T03264                                 

Gene name
NOTCH4
Definition
(RefSeq) notch 4
  KO
K20996  Notch 4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04330  Notch signaling pathway
cjc04919  Thyroid hormone signaling pathway
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05206  MicroRNAs in cancer
cjc05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    108587674 (NOTCH4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    108587674 (NOTCH4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108587674 (NOTCH4)
   05206 MicroRNAs in cancer
    108587674 (NOTCH4)
  09162 Cancer: specific types
   05224 Breast cancer
    108587674 (NOTCH4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    108587674 (NOTCH4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108587674 (NOTCH4)
SSDB
Motif
Pfam: EGF hEGF EGF_CA Ank_5 Ank_2 Ank Notch Ank_3 Ank_4 NODP NOD cEGF EGF_2
Other DBs
NCBI-GeneID: 108587674
NCBI-ProteinID: XP_017826480
Ensembl: ENSCJAG00000001787
LinkDB
Position
4
AA seq 1999 aa
MQSPSLLLLLLLLLRHSVVITRGLQCGSLPEPCANGGTCLSLSEGQGTCQCAPGFLGETC
QFPDPCQNTQLCQNGGSCQALLPAPLGPPSAPTPLAPSFSCTCLLGFTGERCQARLEDPC
PPSFCSKRGRCHIQASGHPQCSCMPGWTGEQCQLRDFCSANPCVNGGVCLATYPQIQCRC
PPGFEGHACERDVNECFQDPGPCPNGTTCHNTLGSFQCLCPVGREGPHCELRAGPCPPRG
CLNGGTCQLMPVKDSTFHLCLCPPGFIGLDCEVNPDNCVSHQCQNGGTCQDGLDTYTCLC
PETWTGWDCSEDLDECEAQGPPRCRNGGTCQNSAGSFHCVCVSGWGGTGCEENLDDCIAA
TCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHGEAQCSTNPLTGSTLCLCQP
GYSGPTCHQDLDECLMAQEGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCETDYNECLSQ
PCHPASTCLDLLATFHCLCPPGLEGQLCEVETNECASAPCLNNADCHDLLNGFQCICPPG
FTGTRCEEDIDECRSSPCANGGQCQDHPGAFHCKCLPGFEGPRCQTEVNECLSDPCPVGA
SCLDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKEQKDKANCLCPDGSPGCAPPE
DNCTCHHGHCQRSSCVCDVGWTGPGCETELGGCVSAPCAHGGTCYPQPSGYNCTCPADYT
GPTCSEEITACHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQSSTDHCVSAPCFNGGTC
VNRPGAFSCVCAVGFQGPRCEGRIRPSCADSPCRNRATCQDSPQGPRCLCSTGYTGGSCQ
TLMDLCAQKPCPRNSHCLQTGPSFYCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSLCQ
NGGLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESRPCQHGATCMAQPNGYLCQCAPGYKG
QNCSKEPDACQSQPCHNHGTCTPQPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGTAA
CHSLANAFYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTCEATAGSPLGFICQCPKGFEGP
TCSHRAPSCGLHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPKGCGPPSPCLY
NGSCTETTGLGGPGFRCSCPHSSPGPRCQKPGAKGCEGRSGDGACDAGCSGPGGNWDGGD
CSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCHDH
FHNGHCEKGCNTAACGWDGGDCRPEDGDPEWGPSLALLVVLSPPALDQQLFALARRLSLT
LRVGLWVRKDRDGRDMVYPYPGARAEEALGGTRDPSNQERAVPQMQPLGKETDSLSAGFV
VVMGVDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAAHSHAANPANQ
LPWPVLCSPVAGVLLLALGALLVLQLIRRRRREHGALWLPPGFTRQPRTQSAPHRRRPPL
GEDSIGLKALKPEAEVDEDGVVMCSGPEEGEEVGQAEETGPPSKCQLWPLSGGCGELPQX
AMLTPPQESEMEAPDLDTRGPDGVTTLMSAVCCGEVESRTFQGAWLGCPEPWEPLLDGGS
CPQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHAAVAADAREVCQ
LLLRSRQTAVDARTEDGTTPLMLAARLAVEDLVEELIAAQADVGARDKWGKTALHWAAAV
NNARAARSLLQGGADKDAQDSREQTPLFLAAREGAVEVAQLLLGLGAARELRDQAGLAPA
DVARQRNHWDLLTLLEGAGPLEARHKATPAREAGPSPRARMASGSVSPHGGGALPRCRTL
SAGAGQRRGGACLQARTSSVDLTARGGGAYSHCRSLSGGGVGGGPPPRGRRFSAGMRGPR
PNPAIKRGRFGVAAGCGGRVSADDWPCDWVALRPCGSASNIPIPPPCLTPSPERGSPQVD
CGPPAHQEMPINPGGEGKK
NT seq 6000 nt   +upstreamnt  +downstreamnt
atgcagtccccttcactgctgctgctgctgctgctgcttctgcgtcactcagtggtcata
acgagagggctgcagtgtgggagtctcccagaaccctgtgccaatggaggcacctgcctg
agcctgtctgagggacaagggacctgccagtgtgcccctggcttcctgggtgagacgtgc
cagtttcctgacccctgccagaacacccagctctgccagaatggaggcagctgccaagcc
ctgcttcctgctcctctagggccccccagcgctcccactccattggcacccagcttttca
tgcacttgcctccttggcttcactggtgagagatgccaggcccggcttgaagacccttgt
cctccctccttctgttccaaaaggggccgttgccacatccaggcctcgggccacccacag
tgctcctgcatgcctggatggacaggtgagcagtgccagcttcgggacttctgctcagcc
aacccatgcgttaatggaggagtgtgtctggccacgtacccccagatccagtgccgctgc
ccacctggcttcgagggccatgcctgtgaacgtgacgtcaacgagtgcttccaggaccca
ggaccctgccccaacggcaccacctgccacaacacgctgggctccttccagtgcctctgc
cctgtgggacgggagggtccacactgtgagctccgggcaggaccctgccctcctaggggc
tgtttgaatggaggcacttgccagctgatgccagtgaaagactccacctttcacctgtgc
ctctgccccccaggtttcataggcctggactgtgaggtgaatccagacaactgtgtcagc
caccagtgtcagaatgggggcacttgccaggatgggctggacacctacacttgcctctgc
ccagaaacctggacaggatgggattgctccgaagatttggatgagtgtgaggctcagggt
ccccctcgctgcagaaacgggggcacctgccagaactctgctggcagctttcactgcgtg
tgtgtgagtggctgggggggcacaggctgcgaggagaacctggatgactgtattgctgcc
acctgtgccccaggatccacctgcattgaccgtgtgggctccttctcctgtctctgccca
cctggacgcacaggactgctgtgccacttggaagacatgtgtctgagccagccgtgccat
ggggaagcccagtgcagcaccaacccactcaccggctccacactctgcctgtgtcagccc
ggctactcagggcccacctgccaccaggacctggacgagtgtctgatggctcaggaaggc
ccaagtccctgtgaacatggaggctcctgcctcaacacccctggctccttcaactgcctc
tgtccacctggctacacgggctcccgttgtgagactgattacaatgagtgcctctcccag
ccctgccacccagcgagcacctgtctggacctacttgccaccttccactgcctctgccca
ccaggcttagaagggcagctctgcgaggtggagaccaacgagtgcgcctcagctccctgc
ctgaacaacgcggactgccatgacctactcaacggcttccagtgcatctgcccacctgga
ttcaccggcacccgctgtgaggaggatattgatgagtgcagaagctctccttgtgccaat
ggtgggcagtgccaggaccaccctggagccttccactgcaagtgtctcccaggctttgaa
gggccacgctgtcaaacagaggtgaatgagtgtctgagtgacccatgccccgttggagcc
agctgccttgacctccccggagccttcttttgcctctgcccctctggattcacaggccag
ctctgcgaggttcccctgtgtgctcccaacctgtgccagcccaagcagatatgtaaggaa
cagaaagacaaggccaactgcctctgtcctgatggaagccctggctgtgccccacctgag
gacaactgcacctgccaccatgggcactgccagagatcctcatgtgtgtgtgacgtgggt
tggacggggccaggatgtgagacagagctagggggctgtgtttccgcaccctgtgcccat
ggggggacctgctacccgcagccctctggctacaactgtacctgccctgcagactacaca
gggcccacctgtagtgaggagataacagcttgccactcagggccatgtctcaatggtggc
tcctgcaaccccagccctggaggctactactgcacctgccctccaagccacacagggccc
cagtgccaaagcagcaccgaccactgcgtgtctgccccgtgcttcaatgggggtacctgt
gtgaacaggcctggcgccttctcctgtgtctgtgccgtgggcttccagggccctcgctgt
gagggaaggatccgccccagctgtgcagacagcccctgcaggaatagagcaacctgccag
gacagccctcagggtccccgctgcctctgctccactggctacaccggaggcagttgccag
actctgatggacttatgtgcccagaagccctgtccacgcaattcccactgcctccagact
gggccttcgttctactgcctgtgcctccagggatggaccgggcctctctgcaaccttcca
ctgtcctcctgccagaaagcagcactgagtcaaggcatagacgtctcttccctttgccag
aatggaggcctctgtgtcgacagtggcccctcttatttctgccactgcccccctggattc
caaggcagcctgtgccaggatcatgtgaacccatgtgagtccaggccttgccagcatggg
gctacctgcatggcacagcccaatgggtatctctgtcagtgcgccccaggctacaaggga
cagaactgctcaaaggaaccggatgcttgtcagtcccaaccctgtcacaaccatggaacc
tgcaccccccaacctggaggcttccactgtgcctgccctccaggctttgtggggctacgc
tgtgagggagacgtagacgagtgtctggaccagccctgccaccccacaggcactgcagcc
tgccactctctggccaatgccttctactgccagtgtctgcctggacacacaggccagtgg
tgtgaagtggagatagacccctgccacagccagccctgctttcatggaggtacctgtgag
gccacagcaggatcacctctaggtttcatatgccagtgccccaagggttttgaaggcccc
acctgcagccacagggccccttcctgcggcctccatcactgccaccacggaggcctgtgt
cttccctcccctaagccaggcttcccaccacgctgtgcctgcctcagtggctatgggggt
cctgactgcctgaccccaccagctcctaaaggctgtggccctccctccccatgcctatac
aacggcagctgcacagagaccacgggcttggggggcccaggctttcgatgctcctgccct
cacagctctccagggccccggtgtcagaagcctggagccaaggggtgtgagggcagaagt
ggagatggggcctgtgatgctggctgcagtggcccaggaggaaactgggatggaggggac
tgctctctaggggtcccagacccctggaagggctgcccctcccactctcggtgctggctt
ctcttccgggatgggcagtgccacccacagtgtgactctgaagagtgtctgtttgatggc
tacgactgtgagactcctccagcctgcactccagcctatgaccagtactgccatgatcac
ttccacaacggacactgtgagaaaggctgcaacactgcagcatgtggctgggatggaggt
gactgcaggccagaagatggggacccagagtgggggccttccctggccctgctggtggtg
ctgagccccccagccctagaccagcaactgtttgccctggcccggaggctgtccctgact
ctgagggtggggctctgggtaaggaaggatcgtgatggcagggacatggtgtacccctat
cctggggcccgagctgaagaggcgctaggaggaactcgagacccctccaatcaggagaga
gcagtccctcaaatgcagcccctgggcaaggagaccgattctctcagtgctgggttcgtg
gtggtaatgggagtggatttatcccgctgtggccctgaccacccggcatcccgctgtccc
tgggaccctgggcttctactccgcttccttgctgcgatggctgcagtgggagccctggag
cccctgctgcctggacccctgctggctgcccactctcatgcagcgaaccctgccaaccag
cttccctggcctgtgctgtgctccccagttgctggggtgcttctcctggccctaggggct
cttctcgtcctccagctcatccggcgtcgacgccgagagcatggagctctctggctgccc
cccgggttcactcgacagcctcggactcagtcagctccccaccgacgccggcccccactc
ggcgaggacagcattggtctcaaggcgctgaagccagaggcagaagttgatgaggatgga
gttgtgatgtgctcaggccctgaggagggagaggaggtgggccaggctgaagaaacaggc
ccaccctccaagtgccagctctggccgctgagtggtggctgtggggagctccctcagnca
gccatgctaactcctccccaggaatccgagatggaagcccctgacctggacacccgtgga
cctgatggggtgacaaccctgatgtcagcagtttgctgtggcgaagtagagtccaggacc
ttccaaggggcatggttgggatgtcctgagccctgggaacctctgctggacggagggtcc
tgtccccaggctcacacagtgggcactggggagacccccctgcacctggctgcccgattc
tcccggccaaccgctgcccgccgcctccttgaggctggagccaatcccaaccagcccgat
cgggcagggcgcacaccccttcatgctgctgtggctgctgatgctcgggaggtctgccag
cttctgctccgtagcagacaaactgcagtggacgctcgcacagaggacgggaccacaccc
ttgatgctggctgccagactggcggtggaagacctagttgaagaactcattgcagcccaa
gcagacgtgggggccagagataaatgggggaaaaccgcgctgcactgggctgctgccgtg
aacaacgcccgagccgcccgctcgcttctccagggcggagccgataaagacgcccaggac
agcagggagcagacgccgctgttcctggcggcacgcgaaggagcggtggaagtagctcag
ctcctgctggggctgggggcagctcgagagctgcgggaccaggctgggctagcgcccgcg
gacgtcgctcgccaacgtaaccactgggatctgctgacgctactggaaggggcggggcca
ctagaggcccgtcacaaagccacaccggcccgcgaggccgggccctcgccgcgcgcacga
atggcgtcaggaagcgtgtccccgcatgggggcggggctctgccgcgctgccggacgctg
tctgcgggagcgggccagcgtcggggcggagcttgtctgcaggctcggacttcgtccgtg
gacttgactgcgcgggggggcggggcctattctcattgccggagcctttcgggaggagga
gtaggaggaggcccgccccctcgcggccgtaggttttctgcaggcatgcgcgggcctcgg
cccaacccagcgataaagcgaggaagattcggagtggctgccgggtgcggaggcagggtc
tcagcggatgactggccctgtgattgggtggccctgagaccttgcggttccgcctccaac
attccgatcccgcctccttgcctcactccgtccccggagcggggatcccctcaagttgac
tgcggtcccccagcccaccaggaaatgcccataaacccaggaggagaaggtaaaaaatag

DBGET integrated database retrieval system