KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393931Help
Entry
100393931         CDS       T03264                                 

Gene name
PPP4C
Definition
(RefSeq) protein phosphatase 4 catalytic subunit
  KO
K15423  serine/threonine-protein phosphatase 4 catalytic subunit [EC:3.1.3.16]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100393931 (PPP4C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100393931 (PPP4C)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100393931 (PPP4C)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100393931 (PPP4C)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-4
    Catalytic subunits
     100393931 (PPP4C)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Protein phosphatase 4
     100393931 (PPP4C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N Metallophos_2
Motif
Other DBs
NCBI-GeneID: 100393931
NCBI-ProteinID: XP_002756082
Ensembl: ENSCJAG00000006846
UniProt: F6S3M7
LinkDB All DBs
Position
12
AA seq 307 aa AA seqDB search
MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFY
DLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQI
TQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTI
DRKQEVPHDGPMCDLLWSDPEDTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQL
VMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKK
PVADYFL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcggagatcagcgacctggaccggcagatcgagcagctgcgtcgctgcgagctcatc
aaggagagcgaagtcaaggccctgtgcgctaaggccagagagatcttggtagaggagagc
aacgtgcagagggtggactcgccagtcacagtgtgcggcgacatccatggacaattctat
gacctcaaagagctgttcagggtgggtggtgacgtccctgagaccaactacctcttcatg
ggggactttgtggaccgtggcttctatagcgtcgaaacgttcctcctgctgctggcactt
aaggttcgatatcctgaccgcatcacactgattcggggcaaccatgagagccgccagatc
acgcaggtctacggcttctacgatgagtgcctgcgcaagtacggctcggtgaccgtgtgg
cgctactgcaccgagatcttcgactacctcagcctgtcggccatcattgatggcaagatc
ttctgtgtgcacgggggcctctccccctccatccagaccctggaccagatccggactatc
gaccgaaagcaagaggtgcctcatgatgggcccatgtgtgacctcctctggtctgaccca
gaagacaccacaggctggggtgtgagcccccgaggggctggctacctgtttggcagtgat
gtggtggcccagttcaacgcagccaatgacattgacatgatctgccgtgcccaccaactg
gtgatggaaggttacaagtggcacttcaacgagaccgtgctcactgtgtggtcagcaccc
aactactgctaccgctgtgggaatgtggcagccatcttggagctggacgagcatctccag
aaagattttatcatctttgaggctgctccccaagagacacggggcatcccctccaagaag
ccggtggccgactacttcctgtga

DBGET integrated database retrieval system