KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394812Help
Entry
100394812         CDS       T03264                                 

Gene name
RPRD2
Definition
(RefSeq) regulation of nuclear pre-mRNA domain containing 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
SSDB OrthologParalogGFIT
Motif
Pfam: CTD_bind CREPT RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 100394812
NCBI-ProteinID: XP_017821729
Ensembl: ENSCJAG00000006424
UniProt: F7EVV0
LinkDB All DBs
Position
18
AA seq 1460 aa AA seqDB search
MAAGGGGGSSKASSSSASSAGALESSLDRKFQSVTNTMESIQGLSSWCIENKKHHSTIVY
HWMKWLRRSAYPHRLNLFYLANDVIQNCKRKNAIIFRESFADVLPEAAALVKDPSVSKSV
ERIFKIWEDRNVYPEEMIVALREALSTTFKTQKQLKENLNKQPNKQWKKSQTSTNPKAAL
KSKIVAEFRSQALIEELLLYKRSEDQIELKEKQLSTMRVDVCSTETLKCLKDKTGGKKFS
KEFEEASSKLEEFVNGLDKQVKNGPSLTEALENAGIFYEAQYKEVKVVANAYKTFANRVN
NLKKKLDQLKSTLPDPEESPVPSPSMDAPSPTGSESPFQGMGGEESQSPTMESEKSATPE
PVTDNRDVEDMELSDVEDDGSKIIVEDRKEKPAEKSAVSTSVPTKPTENISKASSCTPVP
VTMTATPPLPKPVNTSLSPSPALALPNLANVDLAKISSILSSLTSVMKNTGVSPASRPSP
GTPTSPSNLTSGLKTPTPATTSHNPLANILSKVEITPESILSALSKTQTQSAPTLQGLSS
LLQSVTGNPVSASEAASQSTSASPANTTVSTIKGRNLSSSTQPFIPKSFSYSPNSSTSEV
SSTSASKASIGQSPGLPSATFKLPSNSLGFTATHNTSPAAPPTEVTMCQSSEVSKPKLES
ESTSPSLEMKIHNFLKGNPGFSGLNLNIPILSSLGSSAPSESHPSDFQRGPTSTSIDNID
GTPVRDERSGTPTQDEMMDKPTSSSVDTMSLLSKIISPGSSTPSSTRSPPPGRDESYPRE
LSNSVSTYRPFGLGSESPYKQPSDGMERPSSLMDSSQEKFYPDTSFQEDEDYRDFDYSGP
PPSAMMNLEKKPAKSILKSSKLSDTTEYQPILSSYSHRTQEFGVKSAFPPSVRALLDSNE
NCDRLSSSPGLFGAFSVRGNEPGSDRSPSPSKNDSFFTPDSNHNSLSQSTTGHLSLPQKQ
YPDSPHPVPHRSLFSPQNTLAAPTGHPPTSGVEKVLASTISTTSTIEFKNMLKNASRKPS
DDKHFGQAPSKGTPTDGASLSNLTQPSLTATDQQQPEEHYRIETRVSSSCLDLPDSTEEK
GAPIETLGYHNASNRRMSGEPIQTVESIRVPGKGNRGHGREASRVGWFDLSTSGSSFDSS
PSSASELASLGGGGSGGLTGFKTAPYKERAPQFQESVGSFRSNSFNSTFEHHLPPSPLEH
GTPFQREPVGPSSAPPVPPKDHGGIFSRDAPTHLPSVDLSNPFTKEAALAHAAPPPPPGE
HSGIPFPTPPPPPPSGDHSSSGGSGVPFSTPPPPPPPVDHSGVVPFPTPPLAEHGVGGAV
AVFPKDHSSLLQGTLAEHFGVLPGPRDHGVPTQRDLNGPGLSRVRESLTLTSHTLEHLGP
PHGGGGGGGSNSSSGPPLGPSHRDTISRSGMILRSPRPDFRPREPFLSRDPFHSLKRPRP
PFARGPPFFAPKRPFFPPRY
NT seq 4383 nt NT seq  +upstreamnt  +downstreamnt
atggcggccggcggcggcggaggcagcagtaaggcctcctcctcgtcggcctcttcagca
ggggctctggagtcctcgttggatcgaaaattccagtctgtaaccaacaccatggaatcc
attcaaggcttgtcgtcttggtgtatagagaacaagaaacaccacagtactatcgtctac
cattggatgaagtggctccggagatctgcatatccccaccgtttgaatctcttttatctt
gccaatgatgtcatacagaactgtaaaaggaaaaatgcaatcatattccgtgaatcattc
gctgatgtacttcctgaagcagctgctctagtgaaagatccatctgtctccaagtctgta
gaacgaatctttaaaatctgggaagatagaaatgtatacccagaagaaatgattgtggca
ttgagagaagctttgagtaccactttcaaaactcagaagcagctgaaagaaaatctgaac
aaacaaccgaataagcagtggaagaaatcacaaacatctacaaatccaaaagctgctctc
aagtctaagatagttgctgaatttcgatctcaggccctaattgaagagctgttgctatac
aagcgctcagaagatcagatagaactgaaggaaaagcagttgtcaactatgagggtggat
gtgtgcagcacagaaactctcaaatgcttaaaagataaaacaggtgggaagaagttctcc
aaagaatttgaagaggcaagctccaagctggaagaatttgtgaatggattagataagcag
gtgaaaaatggaccctcattaacagaagcactggaaaatgctggaatcttctatgaagca
caatacaaagaagtaaaagtggtggccaatgcatataaaacctttgctaaccgagtaaac
aatttaaagaagaagttggatcaattgaagtcaacccttccagatcctgaagaatcacca
gttccttctccaagcatggacgctccctccccgactggttctgagtctccttttcaggga
atgggaggtgaggaatcacagtcacccaccatggagagtgagaaatctgccacacctgaa
cctgtgacagataatcgtgatgtggaagacatggaactctcagatgtggaagatgatggg
tcaaaaatcattgtggaggacaggaaggaaaaacctgcagagaagtcagctgtatccact
tctgtacctacaaagccaacagaaaatatctccaaggcctcttcatgtaccccagtgcct
gtgaccatgacagcaacgccacctcttccaaaacctgtgaatacttctctttccccttcc
ccagcattggctttgccaaacctggctaatgtggatctggcaaagatcagttccatcctt
agcagtttgacgtcagtcatgaaaaatactggggtcagtcctgcatcaagaccatctcca
ggaactcccaccagccccagcaacctcaccagtggcctgaaaacacctacacctgccacg
acatctcacaaccctctggcaaatatcctctccaaggtggagatcaccccagagagcatt
ctgtctgcactttccaaaacccagacacagtcagcccctacactgcaaggcctgtcatct
ttacttcagagtgttactgggaacccagtttcagccagtgaagctgcctcacagagcact
tcagcttcccctgccaacaccacagtctctaccataaagggaagaaatttgtcctccagt
acccaaccttttattcccaaaagcttcagctattctcctaactcatcaacttctgaagtc
tcttcaacttcagccagcaaggcctcaattgggcaaagcccagggctcccaagcgctact
tttaaactaccatccaactctctggggtttacagctacccacaatactagccctgctgcc
ccacctactgaagttaccatgtgccaatcttcagaggtctccaagccaaaactggagtca
gagtccacctccccaagcttggaaatgaagatccacaacttcttaaaaggtaaccctggt
ttcagtggcttaaacttaaacatcccaatcctgagcagtttggggtccagcgccccatca
gagagccatccctcagacttccagcgtggccctactagcacctcaatcgacaacattgat
ggaacccctgtacgggatgaacggagtgggacacccacccaggatgagatgatggacaag
cccacatccagcagtgtagataccatgtctctgctttctaagatcattagccctggttcc
tcaacacccagcagtacaagatcaccaccccctgggagagatgaaagctatccccgagag
ctctccaattctgtatctacatatcgaccctttggtctgggcagtgaatctccctataag
cagccttctgatggaatggagagaccatcttccctgatggactcttcacaggaaaagttc
tacccagatacttctttccaagaagatgaggattaccgagattttgactattcagggcct
ccaccctctgccatgatgaacctagagaagaaaccagccaaatctatcctgaaatcaagc
aagctgtctgataccaccgagtaccagccaattctgtccagttatagccacagaacccaa
gaatttggggtaaagtctgccttccctccatctgtaagggccctgctggactctaatgag
aactgtgaccgtctctcatcttcccctgggctatttggtgccttcagcgtaagagggaat
gaacctgggtctgaccggtcaccatcaccgagtaagaatgattcatttttcacccctgac
tccaaccacaatagcttgtctcaatctaccactgggcatctcagtttgccacagaagcag
tacccagactctcctcacccagtcccacatcgttcccttttctctccgcagaacaccctt
gccgctcccacgggtcacccacccacatcaggcgtggagaaagtcctggcctccaccatt
tccaccacgtcgacgattgaatttaagaatatgcttaaaaacgcctcacgtaagccctca
gatgataagcattttggccaggcccccagcaagggcactccaactgatggtgccagtctc
tcaaacctcacccagcccagcttgaccgccactgatcagcagcaaccagaagagcactac
cgcatagaaacccgcgtctcctcctcctgcttagacttgcctgatagcacagaagaaaag
ggggcccctatagaaaccttgggttatcacaatgcatccaataggaggatgtcaggggag
ccgatccagaccgtagagtccatccgagttcctgggaagggaaatagaggacacgggcgt
gaggcttcaagggtgggttggtttgatctgagcacatcaggtagctcttttgacagtagc
ccctcaagtgcctctgagttggcatcccttgggggtgggggcagcggaggcctcactggc
tttaaaacagcaccatacaaagaacgggcaccccaatttcaggagagtgtcggcagcttc
cgttccaacagtttcaactcaacatttgagcatcatcttcccccgtcccccttggaacat
gggacacctttccaaagagagccagtggggccatcatctgccccacctgtccctcctaag
gatcatggtggtatcttctctcgagatgcacccactcatctaccctctgtggatctttcg
aaccccttcacaaaggaggcagccctggcccatgctgccccaccccctcctcctggagag
cacagtggaattcctttccctaccccacctcctcctcccccctctggggatcatagcagc
agtggtgggagtggtgtccccttttctactccaccccctcctccaccacctgttgaccac
tctggagttgtacccttcccaaccccaccactggcagagcacggagtgggaggggctgtg
gcagtatttcccaaggaccatagttccctccttcaagggaccctggctgagcattttggg
gtgctcccaggacccagggaccacggggtccccacccaacgggacctcaacggccctggt
cttagccgtgtacgagagagcctgaccctaacctcccatactctggaacacctgggccca
ccccatggaggaggaggtgggggaggcagcaacagcagcagtggcccccccttgggtccc
tcacacagagacaccatcagccggagtggtatgatcttacggagtccccggccagacttt
cggcctagggaaccttttctcagcagagacccatttcacagtttaaagagacccaggcca
ccttttgctaggggccctccgttctttgcaccaaaacgcccattctttcctcccaggtac
tga

DBGET integrated database retrieval system