KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394829
Entry
100394829         CDS       T03264                                 

Gene name
GLP1R
Definition
(RefSeq) glucagon like peptide 1 receptor
  KO
K04581  glucagon-like peptide 1 receptor
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04024  cAMP signaling pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100394829 (GLP1R)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100394829 (GLP1R)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100394829 (GLP1R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100394829 (GLP1R)
G protein-coupled receptors [BR:cjc04030]
 Secretin receptor family
  Pancreatic peptide
   Glucagon
    100394829 (GLP1R)
SSDB
Motif
Pfam: 7tm_2 HRM
Other DBs
NCBI-GeneID: 100394829
NCBI-ProteinID: XP_017826271
Ensembl: ENSCJAG00000005874
LinkDB
Position
4
AA seq 485 aa
LLTLFQKWLIPGRVWAFIEIEKPSILGGEGSGEGLTESTGLPCISFPQGAPVSLLETMQK
WEEYQRQCQRNLSEAPPPATGLFCNRSFDGYACWPDGPPGSFVNVSCPWYLPWASSVLQG
HVYRFCTAEGLWLHKDNSSLPWRDLSECLESNRGERSSPEEQLLSLYIIYTVGYALSFSA
LVIASAILLGFRHLHCTRNYIHLNLFASFILRALSVFIKDATLKWMYSTAARQHQWDELL
SYQDSLGCRLVFLLMQYCVAANYYWLLVEGVYLYTLLAFSVFSEQRIFRLYVSIGWGVPL
LFVVPWGIVKYLYEDEGCWTRNSNMNYWLIIRLPILFAIGVNFLIFIRVICIVVSKLKAN
LMCKTDIKCRLAKSTLTLIPLLGTHEVIFAFVMDEHARGTLRFIKLFTELSFTSFQGLMV
AILYCFVNSEVQLEFWKSWERWRLEHLHIQRDSSMKPLKCPTSSLSSGATVGSSVYAATC
QISCS
NT seq 1458 nt   +upstreamnt  +downstreamnt
cttctcactctctttcagaaatggctgatccctggcagagtttgggctttcatagagatc
gagaaaccaagtatattagggggtgaggggtcaggagaggggctgactgaatccacaggc
ctcccatgtatttccttcccccagggtgctcctgtgtccctcttggagacaatgcagaaa
tgggaagaatatcaacgccagtgccagcgcaacctgagtgaggctccacctcctgccaca
ggcctgttctgcaaccggagctttgatggctacgcctgctggccggatgggccaccaggt
tccttcgtgaatgtcagctgtccctggtacctgccctgggccagcagtgtgctacagggc
cacgtgtaccggttctgcacagctgagggcctctggctgcacaaggacaactccagcctg
ccctggagggacttgtcggagtgcctggagtccaatcgaggggagagaagctccccagag
gagcagctcctgtccctctacatcatctacacggtgggctacgcactctccttctctgct
ctggtcattgcctctgcgatcctcctcggcttcagacacctgcactgcacccggaactac
atccacctgaacctgtttgcatccttcatcctgcgagcactgtctgtgttcatcaaggac
gcaaccctcaagtggatgtatagcacggctgcccggcagcaccagtgggatgagctcctc
tcctaccaggactctctgggctgccgcctggtgtttctgctcatgcagtactgtgtggcg
gccaattactactggctcttggtggagggcgtgtacctgtacacactgctggccttctca
gtcttctccgagcaacgaatcttcaggctctatgtgagcataggctggggtgtccccctg
ctgttcgttgtcccctggggcattgtcaagtacctgtatgaggatgagggctgctggacc
aggaattccaacatgaactactggctcattatccggctgcccattctctttgccattggg
gtgaacttcctcatctttattcgggtcatctgcatcgtggtatccaaactgaaggccaat
ctcatgtgcaagacagacatcaaatgcagacttgccaagtccacgctgacactcatcccc
ctgctggggactcatgaggtcatctttgcctttgtgatggatgagcatgcccgagggacc
ctgcgcttcatcaagctgttcacggagctctccttcacctccttccaggggctgatggtg
gccatcttatactgctttgtcaacagtgaggtccagctggagttttggaagtcctgggag
cgctggcggctggagcacttgcacatccagagggacagcagcatgaagcccctcaagtgt
cccaccagcagcctaagcagcggggccacggtgggcagcagcgtgtatgcagccacctgt
caaatctcctgcagctga

DBGET integrated database retrieval system