KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394916
Entry
100394916         CDS       T03264                                 

Gene name
NR3C1, GR, GRL
Definition
(RefSeq) nuclear receptor subfamily 3 group C member 1
  KO
K05771  glucocorticoid receptor
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100394916 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100394916 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:cjc03310]
    100394916 (NR3C1)
Transcription factors [BR:cjc03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    100394916 (NR3C1)
Nuclear receptors [BR:cjc03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   100394916 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100394916
NCBI-ProteinID: NP_001244179
Ensembl: ENSCJAG00000018337
UniProt: Q6XLJ0 U3EM87
LinkDB
Position
2
AA seq 777 aa
MDSKESLTPGKEENPSSVLTQERGNVMDFCKILRGGATLKVSVSSTSLAAASQSDPKQQR
LLVDFPKGSVSNVQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLQ
LLEESIANLNRSTSVPENPKSSASSSVSAAPKEKEFPKTHSDVSSEQQNLKGQTGTNGGN
VKLYTADQSTFDILQDLEFSSGSPGKERNQSPWRSDLLIDENCLLSPLAGEEDSFLLEGN
SNEDCKPLILPDTKPKIKDNGDLVLSSSSNVTLPQVKTEKEDFIELCTPGVIKQEKLSTV
YCQASFPGANIIGNKMSAISIHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVG
SENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKL
CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRK
CLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPANKTIVPATLPQLTPTLVSLLEVIE
PEVLYAGYDSTVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSW
MFLMAFALGWRSYRQASSNLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSY
EEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTK
LLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQLPKYSNGNIKKLLFHQK
NT seq 2334 nt   +upstreamnt  +downstreamnt
atggactccaaagaatcattaactcctggtaaagaagaaaatccgagtagtgtgcttact
caggagaggggaaatgtgatggacttctgtaaaatcctaaggggaggagctactctgaag
gtttctgtatcttcaacctcactggctgctgcatctcagtcagaccccaagcagcaaagg
cttttggttgattttccaaaaggctcagtaagcaatgtgcagcagccagatctgtccaaa
gcagtttcactctcaatgggactgtatatgggagaaacagaaacaaaagtaatgggaaat
gacctgggattcccacagcagggccaaatcagcctctcctcaggggaaacagacttacag
cttctggaagaaagcattgcaaacctcaataggtcgaccagtgttccagagaaccccaag
agttcagcatcctcttccgtgtctgctgcccccaaagagaaggagtttccaaaaactcac
tctgatgtatcttcagaacagcaaaatttgaagggccagactggcaccaacggtggcaat
gtgaaattgtataccgcagaccaaagtacctttgacattttgcaggatttggagttttct
tctgggtccccaggtaaagagaggaatcagagtccttggagatcagacctgttgatagat
gaaaactgtttgctttctcctctggcgggagaagaggattcattccttttggaaggaaac
tcgaatgaggactgcaagcctctcattttaccggacactaaacctaaaattaaggataat
ggagatctggttttgtcaagctccagtaatgtaacactgccccaagtgaaaacagaaaaa
gaagatttcatcgaactctgcacccctggggtaattaagcaagagaaactgagcacagtt
tactgtcaggcaagctttcctggagcaaatataattggtaataaaatgtctgccatttct
attcatggtgtgagtacctctggaggacagatgtaccactatgacatgaatacagcatcc
ctttctcaacagcaggatcagaagcctatttttaatgtcattccaccaattcccgttggt
tctgaaaattggaataggtgccaaggatctggagatgacaacttgacttccttggggact
ctgaacttccctggtcggacggttttttctaatggctactcaagccccagcatgagacca
gacgtaagctctcctccatctagctcctcaacagcaacaacgggaccacctcccaaactc
tgcctggtgtgctctgatgaagcttcaggatgtcattatggagtcttaacttgtggaagc
tgtaaagttttcttcaaaagagcagtggaaggacagcacaattatttgtgtgctggaagg
aatgattgcatcatcgataaaattcgaagaaaaaactgcccagcatgccgctatcgaaaa
tgtctccaagctggaatgaacctggaagctcgaaaaacaaagaaaaaaataaaaggaatt
cagcaggccactacaggagtctcacaagaaacctctgaaaatcctgctaacaaaacaata
gttcctgcaacgttgccacaactcacccctaccctggtgtcactgttggaggttattgaa
cctgaggtgttgtatgcaggttatgacagcactgttccagactcaacttggaggatcatg
accacgctcaacatgttaggagggcggcaagtgattgcagctgtgaaatgggcaaaggcg
ataccaggtttcaggaacttacacctggatgaccaaatgaccctactgcaatactcctgg
atgtttcttatggcatttgccttggggtggagatcatatagacaagcaagttcaaaccta
ctgtgttttgctcctgatctgattattaatgagcagagaatgactctaccctgcatgtac
gaccaatgtaaacatatgctgtatgtttcctctgagttacacaggcttcaggtatcttat
gaagagtatctctgtatgaaaactttactgcttctctcttcagttcctaaggatggtttg
aagagccaagagctatttgatgaaattagaatgacctacatcaaagagctaggaaaagcc
attgtgaagagggaaggaaactccagccagaactggcagcggttttatcaactgacaaaa
ctcttggattctatgcatgaagtggttgaaaatctccttaactattgcttccaaacattt
ttggataagaccatgagtattgaattcccagagatgttagctgaaatcatcaccaatcag
ctaccaaaatattcaaatggaaatatcaaaaaacttctgtttcatcaaaagtga

DBGET integrated database retrieval system