KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394985
Entry
100394985         CDS       T03264                                 

Gene name
IGF1
Definition
(RefSeq) insulin like growth factor 1
  KO
K05459  insulin-like growth factor 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04068  FoxO signaling pathway
cjc04114  Oocyte meiosis
cjc04115  p53 signaling pathway
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04510  Focal adhesion
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04730  Long-term depression
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04913  Ovarian steroidogenesis
cjc04914  Progesterone-mediated oocyte maturation
cjc04935  Growth hormone synthesis, secretion and action
cjc04960  Aldosterone-regulated sodium reabsorption
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05205  Proteoglycans in cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05218  Melanoma
cjc05224  Breast cancer
cjc05410  Hypertrophic cardiomyopathy
cjc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100394985 (IGF1)
   04014 Ras signaling pathway
    100394985 (IGF1)
   04015 Rap1 signaling pathway
    100394985 (IGF1)
   04066 HIF-1 signaling pathway
    100394985 (IGF1)
   04068 FoxO signaling pathway
    100394985 (IGF1)
   04151 PI3K-Akt signaling pathway
    100394985 (IGF1)
   04152 AMPK signaling pathway
    100394985 (IGF1)
   04150 mTOR signaling pathway
    100394985 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100394985 (IGF1)
   04115 p53 signaling pathway
    100394985 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100394985 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100394985 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100394985 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    100394985 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    100394985 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100394985 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    100394985 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100394985 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    100394985 (IGF1)
   04213 Longevity regulating pathway - multiple species
    100394985 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100394985 (IGF1)
   05202 Transcriptional misregulation in cancer
    100394985 (IGF1)
   05205 Proteoglycans in cancer
    100394985 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    100394985 (IGF1)
   05218 Melanoma
    100394985 (IGF1)
   05215 Prostate cancer
    100394985 (IGF1)
   05224 Breast cancer
    100394985 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100394985 (IGF1)
   05414 Dilated cardiomyopathy
    100394985 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100394985 (IGF1)
   01522 Endocrine resistance
    100394985 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100394985 (IGF1)
Cytokines and growth factors [BR:cjc04052]
 Growth factors
  Growth factors (RTK binding)
   100394985 (IGF1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 100394985
NCBI-ProteinID: XP_002752957
Ensembl: ENSCJAG00000014307
UniProt: F7IBQ8
LinkDB
Position
9
AA seq 153 aa
MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGERGFYFNKPTGYGSSSRRVPQTGIVNECCFRSCDLRRLEMYCAPLKPVKSARS
ARAQRHTDMPKTQKEVHLKNASRGSAGNKNYRM
NT seq 462 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg
aaggtgaagatgcacaccatgtcctcctcgcatctcttctacctggctctgtgcctgctc
accttcaccagctctgccacagctggaccggagacgctctgcggggctgagctggtggat
gctctccagttcgtgtgtggagaaagaggcttttatttcaacaagcccactgggtatggc
tccagcagtcggagggtgcctcagacaggcatcgtgaatgagtgctgcttccggagctgt
gatctgaggagactggagatgtactgcgcacccctcaagcctgtcaagtcagcccgctct
gcccgtgcccagcgccacactgacatgcccaagacccagaaggaagtacatctgaagaat
gcaagtagagggagtgcaggaaacaagaactacagaatgtag

DBGET integrated database retrieval system