KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395149
Entry
100395149         CDS       T03264                                 

Gene name
SIRT1
Definition
(RefSeq) sirtuin 1
  KO
K11411  NAD+-dependent protein deacetylase sirtuin 1 [EC:2.3.1.286]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00760  Nicotinate and nicotinamide metabolism
cjc01100  Metabolic pathways
cjc04068  FoxO signaling pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04218  Cellular senescence
cjc04922  Glucagon signaling pathway
cjc05031  Amphetamine addiction
cjc05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    100395149 (SIRT1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100395149 (SIRT1)
   04152 AMPK signaling pathway
    100395149 (SIRT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100395149 (SIRT1)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100395149 (SIRT1)
  09149 Aging
   04211 Longevity regulating pathway
    100395149 (SIRT1)
   04213 Longevity regulating pathway - multiple species
    100395149 (SIRT1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100395149 (SIRT1)
  09165 Substance dependence
   05031 Amphetamine addiction
    100395149 (SIRT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100395149 (SIRT1)
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100395149 (SIRT1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.286  protein acetyllysine N-acetyltransferase
     100395149 (SIRT1)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     100395149 (SIRT1)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100395149 (SIRT1)
SSDB
Motif
Pfam: SIR2 TPP_enzyme_M DUF592
Other DBs
NCBI-GeneID: 100395149
NCBI-ProteinID: XP_002756358
Ensembl: ENSCJAG00000019318
LinkDB
Position
12
AA seq 753 aa
MADEAALVLQPGGSPSAAAAEREAASPPAGEPLRKRPRRDGPGPERSPNELGGTAPEREV
PAAAESCPAAAAALWREAEAGEGGAAAAGGEQEAQATAVAGEGDNGPGLQGLSQEPPPAD
DFYDEDDDDDDEGDEEEEAAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSD
WTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRK
KRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQA
MFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAG
IQRIIQCHGSFAAASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFG
ENLPEQFHRAMKYDKDEADLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFD
VELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHIS
EDSSSPERTSPPDSSVIVTLLDQATNSNVDDLDVSESKGCMEEKPQEVQTSRNVESISEQ
MENPDLKNVGSSTGEKNERTSVAGTVRKCWPSRVAKEQISKRLDGNQYLFLPPNRYIFHG
AEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGE
AGFGTDGDDQEAINEAVSMKQEVTDMNYASNKS
NT seq 2262 nt   +upstreamnt  +downstreamnt
atggcggacgaggcggccctggtccttcagcccggcggctccccctcggcggcggcggcc
gagagggaggccgcgtccccgcccgccggggagccgctccgcaagaggccgcggagagat
ggtcctggccccgagcggagcccgaacgagctcggtgggacggccccggagcgtgaggtg
ccggcggcggccgagagctgcccggcggctgcggcggcgctgtggcgggaggcggaggca
ggggaagggggagcggcggcggcgggcggggaacaagaggcccaggcgacggccgtggct
ggggaaggagacaatgggccgggcctgcagggcctatctcaggagccaccgccggctgac
gacttctacgacgaagacgacgacgacgacgacgagggcgacgaggaggaagaggcggcg
gcggcggcggcgattgggtaccgagataaccttctgttcggtgatgaaattatcactaat
ggttttcattcctgtgaaagtgatgaggaggatagagcctcacatgcaagctctagtgac
tggactccaaggccacggataggtccatatacttttgttcagcagcatcttatgattggc
acagatcctcgaacaattcttaaagatttattgccggaaacaattcctccacctgaattg
gatgacatgacactatggcagattgttattaacatcctttcagaaccaccaaaaaggaaa
aaaagaaaagatattaatacaattgaagatgctgtgaaattactacaagagtgcaaaaaa
attatagttttaactggagctggggtgtctgtttcatgtggaatacctgacttcaggtca
agggatggtatttatgctcgccttgctgtagacttcccagatcttccagatcctcaagcg
atgtttgatattgagtatttcagaaaagatccaagaccattcttcaagtttgcaaaggaa
atatatcctgggcaattccagccatctctctgtcacaaattcatagccttgtcagataag
gaaggaaaactacttcgcaactatacccagaacatagacacgctggaacaggttgcagga
atccaaaggataattcagtgtcatggttcctttgcagcagcatcttgcctgatttgtaaa
tacaaagttgactgtgaagctgttcgaggagatattttcaatcaggtagttcctcgatgt
cctaggtgcccagctgatgaaccgcttgctatcatgaaaccagagattgtgttttttggt
gaaaatttaccagaacagtttcatagagccatgaagtatgacaaagatgaagctgatctc
ctgattgttattgggtcttccctcaaagtaagaccagtagcactaattccaagttctata
ccccatgaagtgcctcagatattaattaatagagaacctttgcctcatctgcattttgat
gtagagcttcttggagactgtgatgtcataattaatgaattgtgtcataggttaggtggt
gaatatgccaaactttgctgtaatcctgtaaagctttcagaaattactgaaaaacctcca
cgaacacaaaaagagttggcttatttgtcagagttgccacccacacctcttcatatttca
gaagactcaagttcaccagaaagaacttcaccaccagattcttcagtgattgtcacactt
ttagaccaagcaactaacagtaatgttgatgatttagacgtgtctgaatcaaaaggttgt
atggaagaaaaaccacaagaagtacagacttctaggaatgttgaaagtatttctgaacag
atggaaaatccggatttgaagaatgtcggttccagtactggggagaaaaatgaaagaact
tcagtggctggaacagtgagaaagtgctggcctagtagagtggcaaaggagcagattagt
aagcggcttgatggtaatcagtatctgtttttgccaccaaatcgttatattttccatggc
gctgaggtatattcagactctgaagatgacgtcttatcctctagttcttgtggcagtaac
agtgatagtgggacatgccagagtccaagtttagaagaacccatggaggatgaaagtgaa
attgaagaattctacaatggcttagaagatgagcctgatgttccagagagagctggagaa
gctggatttgggactgatggagatgatcaagaggcaattaatgaagctgtatctatgaaa
caggaagtaacagacatgaactatgcatcaaacaaatcatag

DBGET integrated database retrieval system