KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395261Help
Entry
100395261         CDS       T03264                                 

Gene name
PPP2CB
Definition
(RefSeq) protein phosphatase 2 catalytic subunit beta
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03015  mRNA surveillance pathway
cjc04071  Sphingolipid signaling pathway
cjc04114  Oocyte meiosis
cjc04136  Autophagy - other
cjc04140  Autophagy - animal
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04350  TGF-beta signaling pathway
cjc04390  Hippo signaling pathway
cjc04530  Tight junction
cjc04728  Dopaminergic synapse
cjc04730  Long-term depression
cjc05142  Chagas disease (American trypanosomiasis)
cjc05160  Hepatitis C
cjc05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100395261 (PPP2CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100395261 (PPP2CB)
   04390 Hippo signaling pathway
    100395261 (PPP2CB)
   04071 Sphingolipid signaling pathway
    100395261 (PPP2CB)
   04151 PI3K-Akt signaling pathway
    100395261 (PPP2CB)
   04152 AMPK signaling pathway
    100395261 (PPP2CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100395261 (PPP2CB)
   04136 Autophagy - other
    100395261 (PPP2CB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100395261 (PPP2CB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100395261 (PPP2CB)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100395261 (PPP2CB)
  09156 Nervous system
   04728 Dopaminergic synapse
    100395261 (PPP2CB)
   04730 Long-term depression
    100395261 (PPP2CB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100395261 (PPP2CB)
   05165 Human papillomavirus infection
    100395261 (PPP2CB)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    100395261 (PPP2CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100395261 (PPP2CB)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100395261 (PPP2CB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100395261 (PPP2CB)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100395261 (PPP2CB)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     100395261 (PPP2CB)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100395261 (PPP2CB)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100395261 (PPP2CB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N Glyco_hydro_65N DUF5378
Motif
Other DBs
NCBI-GeneID: 100395261
NCBI-ProteinID: XP_002756972
Ensembl: ENSCJAG00000012460
UniProt: U3EWF1
LinkDB All DBs
Position
13
AA seq 309 aa AA seqDB search
MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggacgacaaggcgttcaccaaggagctggaccagtgggtcgagcagctgaacgagtgt
aagcagctgaacgagaaccaagtgcggacgctgtgcgagaaggcaaaggaaattttaaca
aaagaatcaaatgtgcaagaggttcgttgcccagttacggtctgtggagatgtgcatggt
caatttcatgatcttatggaactctttagaattggtggaaaatcaccagatacaaactac
ttattcatgggtgactatgtagacagaggatattattcagtggagactgtgactcttctt
gtagcattaaaggtgcgttatccagaacgcattacaatattgagaggaaatcacgaaagc
cgacaaattactcaagtatatggcttttatgatgaatgtctgcgaaagtatgggaatgcc
aatgtttggaaatattttacagatctctttgattatcttccacttacagctttagtagat
gggcagatattctgcctccatggtggcctctctccatccatagacacactggatcatata
agagccctggatcgtttacaggaagttcctcatgagggcccaatgtgtgatctgttatgg
tcagatccagatgatcgtggtggatggggtatttcaccacgtggtgctggctacacattt
ggacaagacatttctgaaacctttaaccatgccaatggtctcacactggtttctcgtgcc
caccagcttgtaatggagggatacaattggtgtcatgatcggaatgtggttaccattttc
agtgcacccaattactgttatcgttgtgggaaccaggctgctatcatggaattagatgac
actttaaaatattccttccttcagtttgacccagcgccccgtcgtggcgagcctcatgtt
acacggcgcaccccagactacttcctataa

DBGET integrated database retrieval system