KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395287
Entry
100395287         CDS       T03264                                 

Gene name
NCK1
Definition
(RefSeq) NCK adaptor protein 1
  KO
K07365  NCK adaptor protein 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04012  ErbB signaling pathway
cjc04360  Axon guidance
cjc04660  T cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100395287 (NCK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100395287 (NCK1)
  09158 Development and regeneration
   04360 Axon guidance
    100395287 (NCK1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:cjc04990]
    100395287 (NCK1)
Domain-containing proteins not elsewhere classified [BR:cjc04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   100395287 (NCK1)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2
Other DBs
NCBI-GeneID: 100395287
NCBI-ProteinID: XP_017821324
Ensembl: ENSCJAG00000002476
LinkDB
Position
17
AA seq 377 aa
MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKN
SARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAE
REDELSLIKGTKVIVMEKCSDGWWRGSYNGQIGWFPSNYVTEESDSPLGDHVGSLSEKLA
AVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDIMDVIEKPXNDPEWWKCRKINGMVG
LVPKNYVTIMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG
HEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAP
IFTSEQGEKLYLVKHLS
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcagaagaagtggtggtagtagccaaatttgattatgtggctcaacaagaacaagaa
ttggacatcaagaagaatgagagattatggctcctggatgattctaagtcctggtggcga
gttcgaaattccatgaataaaacaggttttgtgccttctaactatgtggaaaggaaaaac
agtgctcggaaagcatctattgtaaaaaacctaaaagataccctaggcattggaaaagtg
aaaagaaaacctagtgtgccagattctgcatctcctgctgatgatagttttgttgaccca
ggggaacgtctctatgacctcaacatgcccgcttatgtgaaatttaactacatggctgaa
agagaggatgaattatcattgataaagggtacaaaggtgatcgtcatggagaaatgcagt
gatgggtggtggcgtggtagctacaatggacaaattggatggttcccttcaaactatgta
actgaagaaagtgacagtcctttgggtgaccatgtgggttctctgtcagagaaattagca
gcagtcgtcaataacctgaatactgggcaagtgttgcatgtggtacaggctctttaccca
ttcagctcatctaacgatgaagaacttaatttcgagaaaggagatataatggatgttatt
gaaaaacctngaaatgacccagagtggtggaaatgcaggaagatcaatggtatggttggt
ctagtaccaaaaaactatgttaccattatgcagaataatccattaacctcaggtttggaa
ccatcacctccacagtgtgattacattaggccttcactcactggaaagtttgctggcaat
ccttggtattatggcaaagtcactaggcatcaagcagaaatggcattaaatgaaagagga
catgaaggggatttcctcattcgtgatagcgaatcttcgccaaatgatttctctgtatca
ctaaaagcacaagggaaaaacaagcattttaaagtccaactaaaagaaactgtctactgc
attgggcagcgcaaattcagcaccatggaagaacttgtagaacattacaaaaaggcgcca
atttttacaagtgaacaaggagaaaaattatatcttgtcaagcatttatcatga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401429
Entry
100401429         CDS       T03264                                 

Gene name
NCK2
Definition
(RefSeq) NCK adaptor protein 2
  KO
K19862  NCK adaptor protein 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04012  ErbB signaling pathway
cjc04360  Axon guidance
cjc04660  T cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100401429 (NCK2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100401429 (NCK2)
  09158 Development and regeneration
   04360 Axon guidance
    100401429 (NCK2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:cjc04990]
    100401429 (NCK2)
Domain-containing proteins not elsewhere classified [BR:cjc04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   100401429 (NCK2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2
Other DBs
NCBI-GeneID: 100401429
NCBI-ProteinID: XP_002757513
Ensembl: ENSCJAG00000008073
UniProt: F7HUY1
LinkDB
Position
14
AA seq 380 aa
MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKN
SLKKGSLVKNLKDTLGLGKTRRKTSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKF
AYVAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAESPSFL
SLRKGASLSNGQGSRVLHVVQTLYPFSSVTDEELNFEKGETMEVIEKPENDPEWWKCKNA
RGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRFAGREWYYGNVTRHQAECALN
ERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDELVEHYK
KAPIFTSEHGEKLYLVRALQ
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgacagaagaagttattgtgatagccaagtgggactacaccgcccagcaggaccaggag
ctggacatcaagaagaatgagcgcctgtggttgctggatgactccaagacatggtggcgg
gtgaggaacgcggccaaccggacaggctatgtgccgtccaactacgtggagcggaagaac
agcctgaagaagggctccctcgtgaagaacctgaaggacacactaggcctcggcaagacg
cgcaggaagaccagcgcgcgggacgcgtcccccacgcccagcacggacgccgagtaccca
gccaacggcagcggcgccgaccgcatctacgacctcaacatccccgcttttgtcaagttc
gcctatgtggcggagcgggaggatgagctgtccctggtgaaggggtcgcgcgtcaccgtc
atggagaagtgcagtgacggttggtggcggggcagctacaatgggcagatcggctggttc
ccctccaactacgtcctggaagaggtggatgaggcggctgcagagtccccgagtttcctg
agcctgcgcaagggcgcctcgctgagcaacggccagggctcccgtgtgctgcacgtggtc
cagacgctgtaccccttcagctccgtcaccgacgaggagctcaactttgagaagggggaa
accatggaggtgatcgagaagcctgagaacgaccccgaatggtggaaatgcaaaaatgcc
cggggccaggtgggcctcgtccccaaaaactacgtggtggtcctcagtgacgggcccgcc
ctgcaccctgcgcacgccccacagataagctacaccgggccctcgtccagtgggcgcttc
gcaggcagagagtggtactacgggaacgtgacgcggcaccaggccgagtgcgccctcaat
gagcgcggcgtagagggcgacttcctcattagggacagcgagtcttcgcccagcgacttc
tccgtgtcccttaaagcgtcagggaagaacaaacacttcaaggtgcagctcgtggacaat
gtctactgcattgggcagcggcgcttccacaccatggacgagctggtggaacactacaaa
aaggcgcccatcttcaccagtgagcacggggagaagctctacctcgtcagggccctgcag
tga

DBGET integrated database retrieval system