KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395600
Entry
100395600         CDS       T03264                                 

Gene name
SHH
Definition
(RefSeq) sonic hedgehog
  KO
K11988  sonic hedgehog
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04340  Hedgehog signaling pathway
cjc04360  Axon guidance
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100395600 (SHH)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100395600 (SHH)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100395600 (SHH)
   05205 Proteoglycans in cancer
    100395600 (SHH)
  09162 Cancer: specific types
   05226 Gastric cancer
    100395600 (SHH)
   05217 Basal cell carcinoma
    100395600 (SHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cjc01002]
    100395600 (SHH)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100395600 (SHH)
Peptidases and inhibitors [BR:cjc01002]
 Cysteine peptidases
  Family C46: hedgehog family
   100395600 (SHH)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Morphogens
   100395600 (SHH)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 100395600
NCBI-ProteinID: XP_002807093
LinkDB
Position
8
AA seq 477 aa
MGEMLLPARCLLLVVVSSLLVCSGLACGPGRGFGKRRHPKKLTPLSYKQFIPNVAEKTLG
ASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQW
PGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYES
KAHIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDQGRLLYSD
FLTFLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSAAGESESSSGVGPPPGD
ALGRRALFASRVRPGQRVYVVAERDGDRRLLPAAVHSVTLLEEATGAYAPLTVQGTSFIH
SGVAFMVWVIEEHSWAHRAFRALRLAHALLAALAPARTDRGGDRGGVGGVDGGVGGDGGG
GGGGGGRVPPPAPGAADDPGAGATAGIHWYSQLLYQIGTWLLDSEALHPLGMAAKSS
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgggcgagatgctgctgccggcgagatgtctgctgctagtcgtcgtctcctcgctgctg
gtgtgctccgggctggcgtgcggacccggcagggggttcggaaagaggcggcaccccaaa
aagctgacccctttatcctacaagcagtttatccccaacgtggccgagaagaccctcggc
gccagcggaaggtatgaagggaagatctccagaaactcggagcgatttaaggaactcacc
cccaattacaaccccgacattatatttaaggatgaggaaaacaccggagcggacaggctg
atgactcagaggtgtaaggacaagttgaacgccttggccatctcggtgatgaaccagtgg
ccaggagtgaaactgcgggtgaccgagggctgggacgaggatggccaccactcagaggag
tctctgcactacgagggccgcgcagtggacattaccacgtccgaccgcgaccgcagcaag
tacggcatgctggcccgcctggcggtggaggccggcttcgactgggtgtactacgagtcc
aaggcgcacatccactgctcggtgaaagcagagaactcggtggcggccaaatcggggggc
tgcttcccgggctcggccacggtgcacctggagcagggcggcaccaagctggtgaaggac
ctccgccccggagaccgcgtgctggcggcggacgaccagggccggctgctctacagcgac
ttcctcactttcctggaccgcgacgacggcgccaagaaggtcttctacgtgatcgagacg
cgggagccgcgcgagcgcctgctgctcaccgccgcgcacctgctcttcgtggcgccgcac
aatgactcggccgctggggagtccgagtcgtcctcaggcgtggggccgcctcccggggac
gcgctggggcgccgggcgctatttgccagccgcgtgcgcccgggccagcgcgtatacgtg
gtggccgagcgcgatggggaccgccggctcctgcctgccgcggtgcacagcgtgaccctg
ctcgaggaggccacgggcgcctacgcgccgctcacggtccagggcacctccttcatccac
tcgggtgtggccttcatggtatgggtcatcgaagagcacagctgggcgcaccgggctttt
cgtgcccttcgcctggcgcacgcgctcctggctgcactggcgcccgcgcgcacggaccgc
ggcggagaccgcggcggcgtgggcggagtggacggcggggtcggcggggacggcgggggc
ggcggcggcggcggcggccgagttcccccgcccgcgccaggtgcggcagacgatccgggc
gcgggggccaccgcgggcatccactggtactcgcagctgctctaccaaataggcacgtgg
ctcctggacagcgaggccctgcaccccctgggcatggcggccaagtccagctga

DBGET integrated database retrieval system