KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395623Help
Entry
100395623         CDS       T03264                                 

Gene name
CNDP1
Definition
(RefSeq) carnosine dipeptidase 1
  KO
K05604  beta-Ala-His dipeptidase [EC:3.4.13.20]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00330  Arginine and proline metabolism
cjc00340  Histidine metabolism
cjc00410  beta-Alanine metabolism
cjc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    100395623 (CNDP1)
   00340 Histidine metabolism
    100395623 (CNDP1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100395623 (CNDP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cjc01002]
    100395623 (CNDP1)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.20  beta-Ala-His dipeptidase
     100395623 (CNDP1)
Peptidases and inhibitors [BR:cjc01002]
 Metallo peptidases
  Family M20
   100395623 (CNDP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 WG_beta_rep
Motif
Other DBs
NCBI-GeneID: 100395623
NCBI-ProteinID: XP_002757384
Ensembl: ENSCJAG00000003184
LinkDB All DBs
Position
13
AA seq 524 aa AA seqDB search
MSKSSLRPPHKLSRCWHRASCTACRMAASLLALLLLLEGGMFSSSSPPPVPLEKVFQYID
LHQDEFVQMLKEWVAIESDSVQPVPHFRQELSRMMAVAVDTLQRLGAHVASVDMGSQQLP
DGQSLPIPPVILAELGNDPTKATVCFYGHLDVQPADRADGWLTDPYMLTEVDGKLYGRGA
TDNKGPVLAWINAVSAFRALEQDLPVNVKFIIEGMEEAGSVALEELMEKEKDRFFSGVDC
VVISDNLWISKRKPAVTYGTRGNSYFTVEVKCRDQDFHSGTFGGILHEPMADLVALLGSL
VDPSGHILVPGIYDEVAPLTEEEVNTYKAIDLDLEEYRNSSQVATFLFDTKEEILMHLWR
YPSLSIHGIEGAFDEPGAKTVIPGRVIGKFSIRLVPHMNVSVVEKQVTQHLEDVFSKRNS
SNKMVVSMALGLHPWIANINNTQYIAAKRAIRTVFGTDPDMIRDGSTIPITKMFQDIVHK
SVVMIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFFEMAQLH
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaagttccttgaggcctccccacaagctaagcagatgctggcaccgtgcttcc
tgtacagcctgcagaatggctgcgtcgctgctggctctgctactgctgctggagggaggc
atgttctcctcgtcctccccacccccggtgccgctagagaaagtcttccagtacattgac
ctccaccaggatgaatttgtgcagatgctgaaggagtgggtggccattgagagcgactct
gtccagcccgtgcctcacttcagacaagagctctccagaatgatggcggtggctgtggac
acactgcagcgcctgggggcccatgtggcctcagtggacatgggttctcagcagctgcct
gatggtcagagtcttccaatacctcccgtcatcctggccgaactggggaacgatcccacc
aaagccaccgtgtgcttctatggccacctggacgtgcagcctgccgaccgggctgatggg
tggctgacggacccctacatgctgacggaggtggatgggaaactttacggacgaggagca
actgacaacaaaggccctgtcttggcttggatcaatgctgtgagcgctttccgagccctg
gagcaagatcttcctgtgaatgtcaaattcatcattgaggggatggaagaggccggctct
gttgccctggaggaacttatggagaaagaaaaggaccgattcttctctggcgtggactgc
gtcgtaatttcagataacctgtggatcagcaaaaggaagccagccgtcacctacggaacg
cgggggaacagctacttcaccgtggaggtgaaatgcagagaccaggattttcactcagga
acctttggtggcatccttcatgaaccaatggctgatctggttgctcttcttggtagcctg
gtagacccgtccggtcatatcctggtccctggaatctatgatgaagtggctcctcttacg
gaagaggaagtaaatacatacaaagccatcgatctggacctggaagaataccggaatagc
agccaggtggcgacgtttctgttcgatactaaggaggagattctaatgcacctctggagg
tacccatctctttctattcatgggatcgagggcgcatttgatgagcctggagctaaaaca
gtcatacctggccgagttataggaaaattttcaatccgtctggtccctcacatgaatgtg
tccgtggtggaaaagcaggtgacacagcatcttgaggatgtgttctccaaaagaaatagt
tccaacaagatggttgtttccatggctcttggactacacccgtggatcgcaaatattaac
aacacccagtatatcgcagccaaaagagccatcagaacagtgtttggaacagacccagat
atgatccgggatggatccaccattccaattaccaaaatgttccaggatatcgtccacaag
agcgtggtaatgattccactgggagctgttgatgatggagaacactcacagaatgagaag
atcaacaggtggaactacatagagggaaccaaactatttgctgcctttttctttgagatg
gcccagctgcattaa

DBGET integrated database retrieval system