KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395704Help
Entry
100395704         CDS       T03264                                 

Gene name
NACA
Definition
(RefSeq) nascent polypeptide-associated complex alpha subunit
  KO
K03626  nascent polypeptide-associated complex subunit alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100395704 (NACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAC RNA_pol_Rpo13
Motif
Other DBs
NCBI-GeneID: 100395704
NCBI-ProteinID: XP_009002285
Ensembl: ENSCJAG00000010701
LinkDB All DBs
Position
9
AA seq 474 aa AA seqDB search
MTSPFPKEAPTTLAVIPPSPKKGPATPAPKETPTLLPVTPSSLKDTPTSPVSVTCKMGAT
VPQASKGLPAKKGPTALKEIFVAPTSESTPVITAPTGKGPQTKKSSAISSPMCPDPSANN
GTKGPPSTVAPAPLLPAQKGSSKTAKGKDASHFPKGPLASPESQASIPLTTAASEKVLPK
PESVSVSLAPTPPVSLPLAPSPVPPLLPTQQFLPSSSGLVLESPSKPLAPADEDELPPLI
PPEPISGGMPFQSVLVNMPTPKSAGIPVPTPSAKQPVLKNNKGSGTESDSDESVPELEEQ
DSTQATTQQAQLAAAAEIDEEPVSKAKQSRSEKKARKAMSKLGLRQVTGVTRVTIRKSKN
ILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQAQLAAAEKFKVQGEAVSNIQENTQTPT
VQEESEEEEVDETGVEVKDIELVMSQANVSRAKAVRALKNNSNDIVNAIMELTM
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgacttctccttttcccaaagaggcccctactactctggctgtgattcctccatccccc
aaaaaaggcccagcaactccagcccccaaagagactcccactttgctacctgtgactcct
tcctccctcaaagacactcctacctccccagtttctgtcacatgtaaaatgggggccact
gttcctcaagcatctaaagggcttccagcaaagaaaggccccacagctctgaaagaaata
tttgttgccccaacttcagaaagtacgccagtcatcacagctcccactgggaaaggtcca
cagactaagaagagttctgctatttcatctcctatgtgcccagatccctcagctaacaat
ggtaccaaaggacctccttccacagtggctccagcccctctactccctgcccagaaaggc
tcttcaaagacagcaaaaggcaaagatgcttctcatttcccaaagggccccttggcttct
cctgagtctcaggcatccatccctctaacaacagctgcctctgagaaagtccttcctaaa
cctgaatcagtatctgtctctctagcacccaccccaccagtctctctgcctcttgctccc
tccccagttccccctctgcttcctacacagcaatttctgccgtcctcttctgggctggtg
ttggaatcaccctctaaacccctagcccctgctgatgaggatgagctgccgcctctgatt
cccccggaaccaatctctgggggaatgcctttccagtcggtcctcgtcaacatgcccacc
cctaaatctgctggaatccctgtcccaaccccctctgccaagcagcccgttctgaagaac
aacaagggatctggaacagaatctgatagtgatgaatcagtaccagagcttgaagaacag
gactccacccaggcaaccacacaacaagcccagctggcagcagcagctgagatagatgaa
gaacctgtcagtaaagcaaaacaaagtcgaagtgaaaagaaggcacggaaggctatgtcc
aaactgggtcttcgacaggttacaggagttactagagtcactatccggaaatctaagaat
atcctctttgtcatcacaaaaccagatgtctacaagagccctgcttcggatacctacata
gtatttggggaagccaagatcgaggatttatctcagcaagcacaactggcagctgctgag
aaattcaaagttcaaggtgaagctgtctcaaacattcaagaaaacacacagactccaact
gtacaagaggagagtgaagaggaagaggtcgatgaaacaggtgtagaagttaaagacata
gaattggtcatgtcacaagcaaatgtgtccagagcaaaggcagtccgagccctgaagaac
aacagtaatgatattgtaaatgctattatggaattaacaatgtaa

DBGET integrated database retrieval system