KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395724Help
Entry
100395724         CDS       T03264                                 

Gene name
SLC22A6
Definition
(RefSeq) solute carrier family 22 member 6
  KO
K08203  MFS transporter, OCT family, solute carrier family 22 (organic anion transporter), member 6
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjc02000]
    100395724 (SLC22A6)
Transporters [BR:cjc02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   100395724 (SLC22A6)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    100395724 (SLC22A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1
Motif
Other DBs
NCBI-GeneID: 100395724
NCBI-ProteinID: XP_009006608
Ensembl: ENSCJAG00000018534
UniProt: U3EFP9
LinkDB All DBs
Position
11
AA seq 550 aa AA seqDB search
MAFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHCRLPAQANLSKD
GGLEAWLPQDRQGRPESCLRFTSPQWGPPFPNGTEANGTGATEPCTDGWIYDNSTFPSTI
VTEWDLVCSHRALRQVAQSLYMVGVLLGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAA
FAPNFPIYCAFRLLSGMSLAGIALNCMTLNVEWMPIHTRACVGTLIGYVYSLGQFLLAGV
AYAVPHWRHLQLLVSVPFFAFFIYSWFFIESARWHSSSGRLDLTLRALQRVARINGKWEE
GAKLSMEVLRASLQKELTMGKGQASAMELLRCPTLRHLFLYLSMLWFATSFAYYGLVMDL
QGFGVSIYLIQVIFGAVDLPAKLVGFLVINSLGRRPAQMAALLLAGICILLNGVVPQDQS
IIRTSLAVLGKGCLAASFNCIFLYTGELYPTMIRQTGLGMGSTMARVGSIVSPLVSMTAE
LYPSMPLFIYGAVPVAASAVTVLLPETLGQPLPDTVHDLENRKGKQRRQQQEHQKYMVPL
QASAQEKNGL
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggcctttaatgacctcctccagcaggtggggggtgtcggccgcttccagcagatccag
gtcaccctggtggtcctccccctgctcctgatggcttctcacaacaccctgcagaacttc
accgccgccatccccacccaccactgccgcctgcctgcccaagccaacctcagcaaggat
ggggggctggaggcctggctgccccaggacaggcaggggcggcctgaatcgtgcctccgc
ttcacctccccacagtggggaccaccctttcccaatggcacagaagccaatggcacaggg
gccacagagccctgcaccgatggatggatctatgacaacagcaccttcccatctaccatc
gtgactgagtgggacctcgtgtgctctcatagggccctacgccaggtggcccagtccttg
tacatggtgggggtgctgctcggagccatggtgttcggctatcttgcagacaggctaggt
cgccggaaggtactgatcttgaactacctgcagacagctgtatcagggacctgcgcggcc
ttcgcacccaacttccccatctactgtgccttccggcttctctcgggcatgtctctggct
ggcatcgccctcaactgcatgacactgaatgtggagtggatgcccatccacacacgggcc
tgcgtgggcaccttgattggctatgtctacagcctgggccagttcctcctggccggagtg
gcctatgctgtgccccactggcgccacctgcagctgctggtctctgtgcccttttttgcc
ttcttcatctactcctggttcttcatcgagtcggcccgctggcactcctcctctggaagg
ctggacctcaccctgagggccctgcagagagtcgcccggatcaatgggaagtgggaagaa
ggagccaagttgagtatggaggtgctccgggccagtctgcagaaggagctgaccatgggc
aaaggccaggcatcggccatggagctgctgcggtgccccaccctccgccacctcttcctc
tacctctccatgctgtggtttgccactagctttgcatactatgggctggtcatggacctg
cagggctttggagtcagcatctacctaatccaggtgatctttggtgctgtggacctgcct
gccaagcttgtgggcttccttgtcatcaactccctgggtcgtcggcctgcccagatggcc
gcattgctgctggcgggcatctgcatcctgctcaatggggtggtaccccaggaccagtcc
attatccgaacctcccttgctgtgctggggaagggctgcctggctgcctccttcaactgc
atcttcctgtacactggggaactgtatcccacgatgatccggcagacaggcttgggaatg
ggcagtaccatggcccgagttggcagcatcgtgagcccgctggtgagcatgactgctgag
ctctacccgtccatgcctctcttcatctatggtgctgttcccgtggctgccagcgctgtc
actgtcctcctgccagagaccctgggccagccactgccggacacggtgcatgacctggag
aacaggaaagggaaacagagacgacagcaacaagagcaccagaagtatatggtcccactg
caggcctcagcacaagagaagaatggactctga

DBGET integrated database retrieval system