KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395878
Entry
100395878         CDS       T03264                                 

Gene name
PYCARD
Definition
(RefSeq) PYD and CARD domain containing
  KO
K12799  apoptosis-associated speck-like protein containing a CARD
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04217  Necroptosis
cjc04621  NOD-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04625  C-type lectin receptor signaling pathway
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05134  Legionellosis
cjc05135  Yersinia infection
cjc05164  Influenza A
cjc05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100395878 (PYCARD)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100395878 (PYCARD)
   04623 Cytosolic DNA-sensing pathway
    100395878 (PYCARD)
   04625 C-type lectin receptor signaling pathway
    100395878 (PYCARD)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100395878 (PYCARD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100395878 (PYCARD)
   05135 Yersinia infection
    100395878 (PYCARD)
   05133 Pertussis
    100395878 (PYCARD)
   05134 Legionellosis
    100395878 (PYCARD)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100395878 (PYCARD)
SSDB
Motif
Pfam: CARD PYRIN CARD_2 SpoIIIAC
Other DBs
NCBI-GeneID: 100395878
NCBI-ProteinID: XP_017818835
LinkDB
Position
12
AA seq 180 aa
MATLRPLVQPKIFKKRIKKFIQHQSDTYVKIKPVDLTDKLVSFYLEAYCAELAATVLRDM
GLQEMAGQLQEATQQGSGAAPAGIRAPPQPAAKPGQHFIDLHRAALIARVTEVEGLLDAL
YAKVLTEEQYQAVRAEPTNPTKMRKLFSFTPAWNWNCKDLFLQALRETQSYLVEDLEQKS
NT seq 543 nt   +upstreamnt  +downstreamnt
atggccaccctcagaccccttgtgcagcccaagatcttcaaaaagagaatcaaaaagttc
atccagcaccagtcagacacatatgtcaaaattaagcccgtggacctcaccgacaagctg
gtcagcttctacctggaggcctactgcgccgagctcgcggcgactgtgctgcgggacatg
ggcctgcaggagatggccgggcagctgcaggaggccacgcagcagggctctggagccgcg
ccagctgggatccgggcccctcctcagccagcagccaagccaggccagcactttatagac
ctgcacagggctgcgcttatcgcgagggtcacagaggttgaggggctgctggatgccctt
tacgcgaaggtcctgacggaggagcagtaccaggcagtgcgagccgagcccaccaaccca
accaagatgcggaagctcttcagcttcacgccagcctggaactggaactgcaaggacttg
ttcctccaggccctgagggagacccagtcctacctggtggaagacctggagcagaagagc
tga

DBGET integrated database retrieval system