KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395945Help
Entry
100395945         CDS       T03264                                 

Gene name
GLS
Definition
(RefSeq) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00220  Arginine biosynthesis
cjc00250  Alanine, aspartate and glutamate metabolism
cjc00471  D-Glutamine and D-glutamate metabolism
cjc01100  Metabolic pathways
cjc04724  Glutamatergic synapse
cjc04727  GABAergic synapse
cjc04964  Proximal tubule bicarbonate reclamation
cjc05206  MicroRNAs in cancer
cjc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100395945 (GLS)
   00220 Arginine biosynthesis
    100395945 (GLS)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    100395945 (GLS)
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    100395945 (GLS)
  09156 Nervous system
   04724 Glutamatergic synapse
    100395945 (GLS)
   04727 GABAergic synapse
    100395945 (GLS)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100395945 (GLS)
   05230 Central carbon metabolism in cancer
    100395945 (GLS)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     100395945 (GLS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glutaminase EF-hand_14 Ank_2 Ank_4 Ank_3 Ank_5 Ank
Motif
Other DBs
NCBI-GeneID: 100395945
NCBI-ProteinID: XP_008997350
Ensembl: ENSCJAG00000005763
UniProt: F6YA69
LinkDB All DBs
Position
6
AA seq 669 aa AA seqDB search
MMRLRGSAMLRDLLLRSPAGVCGTLRRAQPLVTLCRRPRGGGRPAAGPAAAARLHPWWGG
GGWPAGPLARGLSSSPSEILQELGKGSTQPQPGVSPPAAPAAPSPKDGPGETDAFGNSES
KELVASGENKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMD
MLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYESAKK
QSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVNDL
GTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQ
FLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSI
EVTCESASVMAATLANGGFCPISGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPA
KSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKL
DPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAAEGHVE
VVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT
VHKNLDGLL
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggctgcgaggctcggcgatgctgcgggatctgctcctgcggtcgcccgccggc
gtttgcgggactctgaggcgggcacagcccctggtcaccctgtgccggcgtccccggggc
gggggacggccggccgcgggcccggcggccgccgcgcgactccacccgtggtggggcggg
ggaggctggccggcggggcccctagcgcggggcctgtccagctctccctcggagatcttg
caggagctgggcaaggggagcacgcagccgcagcccggggtgtcgccacccgctgccccg
gcggcgcccagccccaaggacggccccggggagactgacgcgtttggcaacagcgagagc
aaagagctggtggcctcaggcgaaaataaaataaaacagggtctgttacctagcttggaa
gatttgctgttctatacaattgcggaaggacaagagaaaatacctgttcataaatttatt
acagcactcaaatctacaggattgcgaacgtccgatcccaggttgaaagagtgtatggat
atgttaagattaactcttcaaacaacatcagatggtgtcatgctagacaaagatcttttt
aaaaaatgtgttcagagcaacattgttttgttgacacaagcctttagaagaaagtttgtc
attcctgactttatgtcttttacctcacacattgatgagttatatgaaagtgctaaaaag
cagtctggaggaaaggttgcagattatattcctcaactggccaaattcagtcctgattta
tggggtgtgtctgtttgtacagtagatggacagaggcattctattggagataccaaagtt
cccttctgtctgcagtcctgtgtaaaacctttgaaatatgccattgctgttaatgatctt
ggaactgaatatgtgcatcgatatgttggaaaagagccgagtggactaagattcaacaaa
ctatttttgaatgaagatgataaaccacataatcctatggtaaatgctggagcaattgtt
gtgacttcattaataaagcaaggagtaaataatgctgagaaatttgactatgtcatgcag
tttttgaataagatggcgggtaacgaatatgttggattcagtaatgcaacgtttcagtct
gaaagagaaagtggagatcgaaattttgcaataggatattacttaaaagaaaagaagtgt
tttccagaaggcactgacatggttggtatattagacttctacttccagctgtgctccatt
gaagtgacttgtgaatcagcaagtgtgatggctgcaacgctggctaatggtggtttctgc
ccaatttctggtgaaagagtactgagccctgaagcagttcgaaatacattgagtttgatg
cattcctgtggcatgtatgacttctcagggcagtttgctttccatgtcggacttcctgca
aaatctggagttgctgggggcattcttttagttgtccccaatgttatgggtatgatgtgc
tggtctcctcctctggataagatgggcaacagtgttaagggaattcacttttgtcacgac
cttgtttctctgtgtaatttccataactatgataatttgagacactttgcaaaaaaactt
gatcctcgaagagaaggtggtgatcaaagggtaaagtcagtgataaatcttttgtttgct
gcatatactggagatgtgtctgcacttcgaagatttgctttgtcggctatggacatggaa
cagcgggactatgattccagaacagcactccatgtagctgctgcagagggtcatgttgaa
gttgttaaatttttgctggaagcctgcaaagtaaaccctttccccaaggacaggtggaac
aacactcccatggatgaagcactgcactttggacaccatgatgtatttaaaattctccaa
gaataccaagtccagtacacacctcaaggagattctgacaacgggaaggagaatcaaact
gtccataagaatcttgatggattgttgtaa

DBGET integrated database retrieval system