KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396125
Entry
100396125         CDS       T03264                                 

Gene name
CCK
Definition
(RefSeq) cholecystokinin
  KO
K05226  cholecystokinin
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04911  Insulin secretion
cjc04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100396125 (CCK)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100396125 (CCK)
  09154 Digestive system
   04972 Pancreatic secretion
    100396125 (CCK)
SSDB
Motif
Pfam: Gastrin
Other DBs
NCBI-GeneID: 100396125
NCBI-ProteinID: XP_002759806
Ensembl: ENSCJAG00000018017
UniProt: U3DR24
LinkDB
Position
17
AA seq 115 aa
MNRGVGLCVLMAVLAAGALTQPVPPGEPAGSGLQRAEEAPRRQLRAVQRTDGESRAHLGA
LLARYIQQARKAPSGRMSVVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
NT seq 348 nt   +upstreamnt  +downstreamnt
atgaaccgcggagtgggcctgtgcgtgctgatggcggtcctggctgccggcgccctgacg
cagccggtgcctcccggagaaccggccggctccgggctgcagagggcagaggaggcgccc
cgaaggcagctaagggccgtgcagagaacggacggcgagtcccgagcgcacctgggcgcg
ctgctggcaagatacatccagcaggcccggaaggctccttctggacgaatgtccgtcgtt
aagaacctgcagaacctggaccccagtcacaggataagtgaccgggactacatgggctgg
atggattttggccggcgcagtgccgaggagtatgagtacccctcctag

DBGET integrated database retrieval system