KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396171
Entry
100396171         CDS       T03264                                 

Gene name
GIP
Definition
(RefSeq) gastric inhibitory polypeptide
  KO
K05258  gastric inhibitory polypeptide
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04024  cAMP signaling pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100396171 (GIP)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100396171 (GIP)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100396171 (GIP)
SSDB
Motif
Pfam: Hormone_2
Other DBs
NCBI-GeneID: 100396171
NCBI-ProteinID: XP_002806900
Ensembl: ENSCJAG00000007300
LinkDB
Position
5
AA seq 151 aa
MVAMKTFTPMLLSLFLAVGLGEKKEGHSSLLPSLPLGSHAKVSSPQPRSPRYAEGTFISD
YSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQREAEALELASQANRKEEEAVEPQRSPP
KNPSNEDLLRDLLIQELLACLVDQTNLCRLR
NT seq 456 nt   +upstreamnt  +downstreamnt
atggtggccatgaagaccttcactccaatgctgctgtccctgttcctggcagtgggacta
ggagagaagaaagagggtcactccagtcttctcccctccctgcctctcggatctcatgct
aaggtgagcagccctcaacctcgaagccccaggtacgccgaggggactttcatcagtgac
tacagtattgccatggacaagattcaccaacaagactttgtgaactggctgctggcccaa
aaggggaagaagaatgactggaagcacaacatcacccagagggaggcagaggcactggag
ctggccagtcaagctaataggaaggaggaggaggcagtggagccacagaggtccccaccc
aagaaccccagcaatgaagatttgcttcgggacttgctgattcaggagctgttggcctgc
ttggtggatcagacaaacctctgcaggctcaggtag

DBGET integrated database retrieval system