KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396682Help
Entry
100396682         CDS       T03264                                 

Definition
(RefSeq) cationic trypsin-3
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04972  Pancreatic secretion
cjc04974  Protein digestion and absorption
cjc05164  Influenza A
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100396682
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    100396682
   04974 Protein digestion and absorption
    100396682
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    100396682
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cjc01002]
    100396682
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100396682
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100396682
Peptidases [BR:cjc01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100396682
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100396682
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 100396682
NCBI-ProteinID: XP_002751962
Ensembl: ENSCJAG00000013826
LinkDB All DBs
Position
8
AA seq 248 aa AA seqDB search
MKTFIFLALLGAAVAFPTSDDDDDKIVGGYTCQKDSVPYQVSLNAGYHFCGGSLINNQWV
VSAAHCYKSRIQVRLGEYNIEVVEGNEQFINAAKIIRHPNYNSATIDNDIMLIKLSSAAT
INSRVSTISLPRSCAATGTQCLISGWGNTLSSGTNYPDLLQCLKAPILSDTACRKAYPGK
ITTNMICLGFLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAQKNRPGVYTKVCNYVKW
IQETIAAN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccttcatctttcttgctctcctgggtgctgctgttgctttccccactagtgat
gatgatgacgacaagattgtcgggggctacacctgtcagaaggattctgtcccctatcag
gtgtccctgaatgctggctatcacttctgtggcggctccctcatcaataaccaatgggtg
gtgtctgcggctcactgctacaagtcccgaatccaagtgcgcctgggagaatacaacatt
gaggttgtggaaggcaatgagcaattcataaacgcggccaagattattcgccaccccaat
tacaattcagccaccatcgataatgacatcatgttgattaagctgagctcagctgccacc
atcaactctcgagtatccaccatctctctgccaagatcctgtgcagcgactggtactcag
tgtctcatctccggctggggcaacaccttgagcagtggcaccaactaccctgatctcctg
cagtgtctgaaggctcccattctctctgacactgcttgccgcaaagcctacccaggcaag
attactacaaatatgatatgtctgggattcctggagggtggaaaggactcttgccagggt
gactctggtggccctgtggtctgcaacggagaactgcagggcgttgtctcctggggctat
ggttgtgctcagaagaacagacccggagtctacaccaaggtttgcaactacgtgaaatgg
attcaggagacgattgctgccaactaa

DBGET integrated database retrieval system