KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396804
Entry
100396804         CDS       T03264                                 

Gene name
IL18
Definition
(RefSeq) interleukin 18
  KO
K05482  interleukin 18
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04061  Viral protein interaction with cytokine and cytokine receptor
cjc04621  NOD-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc05132  Salmonella infection
cjc05134  Legionellosis
cjc05135  Yersinia infection
cjc05143  African trypanosomiasis
cjc05144  Malaria
cjc05152  Tuberculosis
cjc05164  Influenza A
cjc05321  Inflammatory bowel disease
cjc05323  Rheumatoid arthritis
cjc05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100396804 (IL18)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100396804 (IL18)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100396804 (IL18)
   04623 Cytosolic DNA-sensing pathway
    100396804 (IL18)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100396804 (IL18)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100396804 (IL18)
   05135 Yersinia infection
    100396804 (IL18)
   05134 Legionellosis
    100396804 (IL18)
   05152 Tuberculosis
    100396804 (IL18)
  09174 Infectious disease: parasitic
   05144 Malaria
    100396804 (IL18)
   05143 African trypanosomiasis
    100396804 (IL18)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100396804 (IL18)
   05321 Inflammatory bowel disease
    100396804 (IL18)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100396804 (IL18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100396804 (IL18)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100396804 (IL18)
SSDB
Motif
Pfam: IL1
Other DBs
NCBI-GeneID: 100396804
NCBI-ProteinID: XP_002754458
Ensembl: ENSCJAG00000012499
UniProt: U3CWC9
LinkDB
Position
11
AA seq 193 aa
MAAEPVEDNCINFVEMKFTGDALYFRAEDDENLETDHFAKLKSKLAIIRNVDDQVLFLGQ
GNHPLFEDMTDSDCEANASRTIFIIYMYKDSEPRGLAVTISVKCGKISTLSCENKIISFK
EISPPDNITDTKSDIIFFQRSVPGHDDKMQFESSSYEGYFLACKKEEDLFKLILKRKDEL
GDKSLLFTVQSKD
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgctgaaccagtagaagacaattgcatcaactttgtggaaatgaaatttactggc
gatgcactttactttagagctgaagatgatgaaaacctggaaacagatcactttgccaag
cttaaatccaaattagcaattataagaaatgtggatgaccaagttctcttccttggccaa
ggaaatcaccctctgtttgaggatatgactgattctgactgtgaagcaaatgcatcccgg
accatatttattatatatatgtataaagatagcgagcctagaggtctggctgtaaccatc
tctgtgaagtgtggaaaaatttcaactctctcctgtgagaacaaaattatttcctttaag
gaaatcagccctcccgacaacatcactgatacaaaaagtgacatcattttttttcagaga
agtgttccagggcatgatgataagatgcagtttgagtcttcatcatacgaaggctacttt
ttagcctgtaaaaaagaggaagatcttttcaaactcattttgaaaagaaaggatgaattg
ggggataaatccttattgttcacggttcaaagcaaagactag

DBGET integrated database retrieval system