KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396986
Entry
100396986         CDS       T03264                                 

Gene name
AIM2
Definition
(RefSeq) absent in melanoma 2
  KO
K12966  absent in melanoma 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04621  NOD-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100396986 (AIM2)
   04623 Cytosolic DNA-sensing pathway
    100396986 (AIM2)
SSDB
Motif
Pfam: HIN PYRIN
Other DBs
NCBI-GeneID: 100396986
NCBI-ProteinID: XP_008982936
Ensembl: ENSCJAG00000006327
UniProt: A0A5F4VUL6
LinkDB
Position
18
AA seq 343 aa
MESKYKEILLLTGLENITDEELERFKFFLPDEFNIATGKLHTANRPQLANLMIQNAGVVS
AVMKTIHIFQKLNYMLLAKRLQEEKEKVDQKYKPVTKPKPLSQAEMSPAASAAIRKDVTK
QRAAPKVSPHIKPEQKQMVAQQPSIREGFQKDPLPVMVLKAMKPFMFETQEGKQEMFHAT
VATEKEFFFVKVFNTLLRDKFIPKTIIIISRYYRHSGFLEVTSASRVLDAESDQKVNVPP
NIIRKAGETPKISTLQTQPLGTIVNGLFVVRKVTGKKKGVLNLSDNTGNMDVLVAGNQDT
IKCEEGDKLRLTFFTLSKNGEKLQLTSGVHSTIKVIKNQKKKK
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggagagtaaatataaggagatactcctgctaacgggcctggagaacatcactgatgaa
gaactggagaggtttaagttctttcttccagatgagtttaatattgccacaggcaaacta
catactgcaaatagaccacaactagctaacttgatgattcaaaatgctggtgtggtgtct
gcagtaatgaagaccattcatatttttcagaagttgaattacatgcttttggcaaaacgt
cttcaggaagagaaggagaaagttgatcagaaatacaaacccgtaacaaaaccaaagcca
ctaagtcaagctgaaatgagtcctgctgcgtctgcagccatcagaaaagatgtcacaaag
caacgtgctgcaccaaaagtctctcctcatattaagcctgagcagaaacagatggtggcc
cagcagccctctatcagagaagggtttcagaaagaccctttgccggttatggtactgaaa
gcaatgaagcccttcatgtttgagacccaagaaggcaagcaagagatgtttcatgctaca
gtggctaccgagaaggaattcttctttgtaaaagtttttaatacactgctaagagataaa
ttcattccaaagacaataattatcatatcaaggtattatcggcacagcggtttcttagaa
gtaactagtgcctcacgtgtgttagatgctgaatctgaccaaaaggttaatgtccctccg
aacattatcagaaaagctggggaaaccccgaagatcagcacacttcaaactcagcccctt
ggaacaattgtgaatgggttgtttgtagtccggaaggtgacaggaaagaagaaaggtgta
ttaaacctaagtgacaacactgggaatatggatgtactggtggctggaaaccaggacaca
ataaaatgtgaggaaggagataagcttcgacttacgttcttcacactgtcaaaaaatgga
gaaaaactacagctgacatctggagtccacagcaccataaaggttattaagaaccaaaaa
aaaaaaaagtag

DBGET integrated database retrieval system