KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397043Help
Entry
100397043         CDS       T03264                                 

Gene name
MGAM2
Definition
(RefSeq) maltase-glucoamylase 2 (putative)
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00052  Galactose metabolism
cjc00500  Starch and sucrose metabolism
cjc01100  Metabolic pathways
cjc04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100397043 (MGAM2)
   00500 Starch and sucrose metabolism
    100397043 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100397043 (MGAM2)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100397043 (MGAM2)
    3.2.1.20  alpha-glucosidase
     100397043 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100397043
NCBI-ProteinID: XP_017831057
Ensembl: ENSCJAG00000036807
LinkDB All DBs
Position
8
AA seq 1766 aa AA seqDB search
MARKLSVLEVLLIIFCLIVVAVDILLLLLVLEEPSDTSFTPECPEIDQSDRIDCTPGQAV
TEDTCRWKYKCCWLPVADANVPRCIFPRNWGYEASNGHTNTSTGFTAQLKRLPSPSLFGN
DVTTTLFTAEYQTSNRFHFKITDFNNIRYEVSHENIDTVNSTANATNLSYYVEATDKPFS
IKIMRTSNRRVLLDTSIGPLQFAQQYLQLSFRLPSANVYGLGEHVHQQYLHNMTWKTWPI
FTRDATPTEGMINLYGAHTFFLCLEKPSGSSFWECFLLNSNAMEVTLQPAPAITYRTIGG
VLDFYVFLGNTPEQVVQEYLELVGRPFLPSYWSLGFQLSRRDYGGINKLKEVVSRNRLAE
IPYDVQYSDIDYMDGKKDFTVDQDAYSGLSDFVKELHDNGQKYLIIMNPGIAKDSSYEPY
NNGSIKRVWIMGNHGSAVGEGYPGPTVFPDYSNPVCTEWWIYQVINFHNRLEFDGVWIEM
NEVSSLHQASDQCESNTLNFPPFTPRVLDRLLFARTLCMDTEFQGGLHYDFHSLYGYFMA
RATDLALKNIFTDKRSFILSRSTFAGSGKFAAHWLGDNAATWDDLRWSISSILEFNVFGI
PMVGANICGYNNNVTEELCRRWMQLGAFYPLSRNHNGPGFRDQDPAAFGADSLLLNSSRH
YLNIRYTLLPYLYTLFYRAHTRGDTVARPLVHEFYQDSATWELHEQFLWGPGLLITPVLY
EGVDEVKAYIPDATWYDYETGVAIPWRKQFVNMLLPGDKIGLHLRGGYIFPTQKPNTTTE
ASRRNSLGLIIALDYKREANGELYWDDGVSKDAVTGKQYILYDFSVASNHLQAKILFNNY
TDTYNLMFTDITILGMDKQPANFTVLLNNIATSSPSVVYSASTKVVTITDLQGLVLGQEF
SIKWNLPVDDLEKFNCYPDDPTASEESCRQRGCLWEHTSTPGVPTCYYDTIPNYVASDIQ
YQYAGITANLSLLVAPELARAEESRQTAPIPPLPSRDVPPPTAAAAAAAVAASDSLSAKI
SFLRLSVIYHTANMLQVKIYDPTNKRYEVPVPLNTPPQPDDDPENRLYDVRIQNNPFGIQ
IQRRTSSTVIWDSQLPGFTFNDMFLSISTRLPSQYIYGFGETEHTAFRRDMNWNTWGMFA
RDEPPANNKNSYGVHPYYMALEEDGSAHGVLLLNSNAMDVTLQPTPALTYRTTGGILDFY
IVLGPTPELVTQQYTELIGRPAMIPYWALGFQLSRYGYQNDAEISSLYDAMVAAQIPYDV
QHVDIDYMDRKLDFTLSASFENLSLLIEQMKKNGMRFILILDPAISGNETQYLPFIRGQE
NDVFIKWPDTNDIVWGKVWPDLPNVNVDGSLDHETQVKRYRAYVAFPDFFRNNTAAWWKN
EIEELYTNPREPEKSLKFDGLWIDMNEPSNFVDGSVWGCRNEMLNNPPYVPYLESRDKGL
SNKSLCMESQQILPDGSPVQHYNVHSLYGWAQTRPTYEAVQKVTGQQGVVITRSTFPSSG
RWGGHWLGDNRAAWDQLGNSIIGIMEFSLFGIPYTGADICGFFGDAEYEMCVRWMQLGAF
YPFSRNHNNIGSRRQDPVAWNSTFEMLSRKVLETRYTLLPYLYTLMHKAHIEGSTVVRPL
LHEFTDDKTTWDIDRQFMLGPAILISPVLERSTFEISAYFPKALWYDYSTETSNKSIGEW
KILKAPLDHINLHIRGGYILPWQEPAMNTHSSRQNFMGLIVALDDNGKAEGQMFWDDGQS
IDTYENGNYFLANFIAAQVRLIYYNL
NT seq 5301 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaagctcagtgtattggaagtccttctgatcatcttctgcctaattgtggtg
gctgtagatatcctcttgttgcttcttgtattggaggaaccttcagatacttcatttact
ccagagtgtccagagattgaccagtcggacaggatagactgcacacctggccaggcggtg
acagaggatacctgcagatggaaatataagtgctgctggttgcctgtggcagatgccaat
gtccctaggtgcatcttccctaggaactggggctatgaagccagcaatggccatacaaat
acaagcacaggatttactgcccagttgaaaaggttgccatccccatctctgtttggaaat
gatgtcaccaccacccttttcacagctgaatatcagacatccaatcggtttcattttaag
atcactgactttaataacatacgctatgaagtttcccatgaaaatattgacacagttaat
agcactgctaatgccaccaatttgagctattacgtggaggctactgataaacctttcagc
atcaaaataatgaggacaagcaacagaagagtcttgttggacacaagcattgggcccctc
cagtttgcccagcagtacctgcagctgtctttccgactgcccagtgccaatgtgtatgga
ctgggagaacatgtgcaccagcagtacctccacaacatgacctggaagacctggcccatc
ttcacccgggatgccacccccactgagggcatgattaatctgtacggagctcatacattc
ttcttatgccttgaaaaacccagtggctcctctttttgggagtgttttctgttgaacagt
aatgccatggaggttacccttcagccagctcctgcaatcacttaccgcacaattgggggc
gttcttgacttttatgtattcctaggaaacactccagaacaagtggttcaggaatacttg
gagcttgttggacggccattcttgccttcctattggagtcttgggttccagcttagtcgc
agggattatggtggcatcaataaattgaaagaagttgtaagccgaaatcgtttagctgag
ataccatatgatgtccagtactctgacatagactacatggatggaaagaaggatttcact
gttgatcaagatgcttattctggtctctcagattttgtcaaggagttacatgacaatggt
cagaaatatctcattattatgaatcctggcattgccaaagactctagctacgagccttat
aataatggaagcataaagagagtgtggatcatggggaaccatggctctgctgttggggag
ggatatccaggacccacagtctttcccgattatagcaatccagtgtgcactgagtggtgg
atatatcaggtcattaactttcataatcgtctggagtttgatggagtgtggattgaaatg
aatgaagtatctagcttacatcaagcttctgatcagtgtgaatcaaacaccttgaacttt
cctccttttactcctagagttctggaccgcttactatttgcaagaaccctctgcatggac
acggaatttcaagggggccttcactatgacttccacagcttgtatggctacttcatggcc
agagccacagacttagccctgaagaacatcttcacggataaaaggagcttcatcttatcc
cgttctactttcgctggatctggcaaatttgctgctcactggttgggggacaatgcagcc
acatgggatgacctccgatggtctatctccagtatccttgagttcaacgtgtttggcatc
cccatggtaggtgccaacatctgtggttataacaacaatgtcacagaggagctctgcaga
aggtggatgcagcttggagcattttatccactatcaaggaatcacaatgggcctgggttc
agggaccaggatcctgctgcctttggtgctgactccctgctgctgaattcctccagacat
tatctgaacatccgctacaccttactgccctatctctacacccttttctaccgtgcgcac
acccggggagacacggtagcaaggcccctcgtacatgagttctaccaggactcagccacg
tgggagttgcatgagcagttcttatggggacctggactcctcatcacacctgttttatat
gaaggtgtggacgaagtgaaagcatatatacctgatgccacctggtatgactatgagaca
ggagtggccatcccatggaggaagcagtttgtgaatatgctcctcccaggtgataagata
ggacttcatctgcgagggggctacatatttcccacccagaagccaaacacaaccacagaa
gccagcaggaggaattctctgggactcatcattgccttggactataagagagaagcaaac
ggggagctatactgggatgacggtgtatctaaagatgctgtaactggaaagcagtatatt
ctatatgatttctctgttgcctctaatcatctacaagcaaagattctttttaataattat
acggacacgtacaacctaatgtttacagatatcacaatcttgggaatggacaagcagcca
gctaattttactgtcttattgaataatattgccacctccagtccaagcgttgtttatagt
gcttccacaaaggtggtaaccatcactgatctccaaggactcgtactgggacaagaattc
tctattaagtggaatcttcctgtcgatgacctggagaagttcaactgctaccctgatgat
ccaacagcctctgaggagagttgtaggcagcgggggtgtctttgggagcacacatctact
cctggcgtgcccacctgttactatgacaccatccctaattatgttgccagtgacattcag
taccagtacgctggcatcactgcaaacctttccctcctggtggcccctgaattagcacga
gcagaggaatctagacagacagcaccaataccaccactgccatcaagggatgtgccacct
cccactgcagcagccgcagcagctgctgttgccgcctctgattctctctctgcaaagatc
agcttcctccgcctgagtgtgatctatcacacagcaaacatgctgcaggtcaagatctat
gacccaactaataaaagatatgaggtcccagtgccactgaacacccctccccaaccagat
gatgaccctgaaaaccgtctgtatgatgtcaggattcagaacaatccttttggaatccag
attcaacgcagaacctccagcactgtaatttgggattctcaactccccggcttcaccttc
aatgacatgtttctctccatttctacacgtctgccctctcagtacatctatggctttggg
gaaactgagcacacagctttcagaagagacatgaactggaacacctgggggatgtttgct
cgtgatgagccacctgcgaacaacaagaattcctatggtgtccacccttactacatggca
ctggaagaggatggcagtgcccatggagtgctcctgctaaatagcaatgccatggatgtg
acattacagcccactcctgccttgacataccgcaccacaggagggattttggacttttac
attgttttggggccaacccctgaacttgtaactcagcagtacacagagttgatcggtcga
ccagcaatgattccatactgggccttgggattccagctgagtcgctatggataccagaat
gatgctgaaatctccagtttgtatgatgcaatggtggcagcccagattccctatgacgtc
cagcatgtagacatcgattacatggaccggaagctggatttcaccctcagtgccagcttt
gaaaaccttagtctcctgattgagcaaatgaagaaaaatggcatgagatttattctcatt
ttggacccagccatttctggtaatgagacccagtatctcccattcattagaggacaggaa
aatgacgtgttcatcaaatggcctgacaccaatgacattgtctggggaaaggtttggcca
gatctgcctaacgtaaatgtagatggatcccttgaccatgaaactcaggttaagcgatac
agggcctacgttgcttttcctgacttctttcgtaataacacagctgcctggtggaagaac
gagatagaagagctctatacaaaccctcgagagccagagaagagcttaaagtttgatgga
ttgtggattgatatgaatgagccatcaaactttgtggatggatccgtctggggctgcaga
aatgaaatgctaaataacccaccctatgtgccatatttggaatctagggacaagggcctg
agcaacaagagcctgtgcatggagagtcagcagatcctcccagacggctcccccgtgcag
cactacaacgtgcacagcctgtatgggtgggcccagaccagacccacatatgaagctgtg
cagaaggtgacaggacagcaaggggttgtcatcacccgctccacatttccctcttctgga
cgctggggaggacactggctaggagacaacagagctgcgtgggaccaactggggaactct
atcattggcataatggagttcagtctctttggaataccttatacaggagcagatatctgt
gggttctttggagatgctgaatatgagatgtgtgttcgctggatgcaactgggggcattt
tatccattttccagaaaccacaacaacatcgggtcaaggagacaagatcctgtggcctgg
aattcaacctttgagatgttgtccagaaaagtcctggagactagatatactctgcttcct
tatctctatactctgatgcataaagctcacattgagggcagcactgttgtccggcccctt
ctccatgagtttacggatgataagacaacatgggatatagaccgtcagttcatgttgggc
cctgccatcttaatcagccctgtgttggaacgtagcacatttgagatctctgcttatttt
cccaaagcactttggtatgactatagcacggaaactagcaacaaatcaataggtgagtgg
aaaatcctgaaggctcctcttgaccacatcaaccttcacatcagaggaggctacatcctg
ccctggcaagagcctgcaatgaacactcactccagtcgacaaaattttatgggattgatt
gttgctttggatgacaatgggaaagctgaaggccagatgttctgggatgatggacaaagc
attgatacttatgaaaatggaaattattttttggcaaactttatagcagctcaggtaaga
ctaatatactacaatttataa

DBGET integrated database retrieval system