KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397389
Entry
100397389         CDS       T03264                                 

Gene name
MAP2K6
Definition
(RefSeq) mitogen-activated protein kinase kinase 6
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04015  Rap1 signaling pathway
cjc04218  Cellular senescence
cjc04380  Osteoclast differentiation
cjc04620  Toll-like receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04668  TNF signaling pathway
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04912  GnRH signaling pathway
cjc04935  Growth hormone synthesis, secretion and action
cjc05014  Amyotrophic lateral sclerosis
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05132  Salmonella infection
cjc05135  Yersinia infection
cjc05145  Toxoplasmosis
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100397389 (MAP2K6)
   04015 Rap1 signaling pathway
    100397389 (MAP2K6)
   04668 TNF signaling pathway
    100397389 (MAP2K6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100397389 (MAP2K6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100397389 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    100397389 (MAP2K6)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100397389 (MAP2K6)
   04935 Growth hormone synthesis, secretion and action
    100397389 (MAP2K6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100397389 (MAP2K6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100397389 (MAP2K6)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100397389 (MAP2K6)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100397389 (MAP2K6)
   05022 Pathways of neurodegeneration - multiple diseases
    100397389 (MAP2K6)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100397389 (MAP2K6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100397389 (MAP2K6)
   05135 Yersinia infection
    100397389 (MAP2K6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100397389 (MAP2K6)
   05161 Hepatitis B
    100397389 (MAP2K6)
   05163 Human cytomegalovirus infection
    100397389 (MAP2K6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100397389 (MAP2K6)
   05169 Epstein-Barr virus infection
    100397389 (MAP2K6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100397389 (MAP2K6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100397389 (MAP2K6)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100397389 (MAP2K6)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: STE group
  STE7 family
   100397389 (MAP2K6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal Choline_kinase DUF4344 APH
Other DBs
NCBI-GeneID: 100397389
NCBI-ProteinID: XP_002748712
Ensembl: ENSCJAG00000000122
UniProt: F7GTD8
LinkDB
Position
5
AA seq 334 aa
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHESKATDVASFVKLILGD
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtctcagtcgaaaggtaagaagcgaaaccctggccttaaaattccaaaagaagcattt
gagcaacctcagaccagttccacgccacctcgagatttagactccaaggcttgcatttct
attggaaatcagaactttgaggtgaaggcagatgacctggagcctataatggaactggga
cgaggtgcatatggggtggtggagaagatgcggcatgtgcccagcgggcagatcatggca
gtcaagcggatccgagccacagtaaatagccaggaacagaaaaggctactgatggatttg
gatatttccatgaggacagtggactgtccattcactgtcaccttttatggcgcactcttt
cgggagggtgatgtgtggatctgcatggagctcatggatacatcactagataagttctac
aaacaagttattgataaaggccagacaattccagaggacatcttagggaaaatagcagtt
tctattgtaaaagcattagaacatttacacagtaagctgtctgtcattcatagagacgtc
aagccttctaacgtactcattaatgctcttggtcaagtgaagatgtgcgattttggaatc
agtggctacttggtggactctgtagctaaaacaattgatgcaggttgcaagccatacatg
gcccctgaaagaataaatccagagctcaaccagaagggatacagtgtgaagtctgacatt
tggagtctgggcatcacgatgattgagttggccatccttcgatttccctatgattcatgg
ggaactccatttcagcagctcaaacaggtggtagaggagccatcaccacaactcccagca
gacaagttctctgcagagtttgttgactttacctcacagtgcttaaagaagaattccaaa
gaacgacctacatacccagagctaatgcaacatccatttttcaccctacatgaatccaaa
gcaacagatgtggcatcttttgtaaaactgattcttggagactaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398593
Entry
100398593         CDS       T03264                                 

Gene name
MAP2K3
Definition
(RefSeq) mitogen-activated protein kinase kinase 3
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04015  Rap1 signaling pathway
cjc04218  Cellular senescence
cjc04620  Toll-like receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04668  TNF signaling pathway
cjc04714  Thermogenesis
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04912  GnRH signaling pathway
cjc04935  Growth hormone synthesis, secretion and action
cjc05014  Amyotrophic lateral sclerosis
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05132  Salmonella infection
cjc05135  Yersinia infection
cjc05145  Toxoplasmosis
cjc05161  Hepatitis B
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100398593 (MAP2K3)
   04015 Rap1 signaling pathway
    100398593 (MAP2K3)
   04668 TNF signaling pathway
    100398593 (MAP2K3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100398593 (MAP2K3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100398593 (MAP2K3)
   04664 Fc epsilon RI signaling pathway
    100398593 (MAP2K3)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100398593 (MAP2K3)
   04935 Growth hormone synthesis, secretion and action
    100398593 (MAP2K3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100398593 (MAP2K3)
  09159 Environmental adaptation
   04714 Thermogenesis
    100398593 (MAP2K3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100398593 (MAP2K3)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100398593 (MAP2K3)
   05022 Pathways of neurodegeneration - multiple diseases
    100398593 (MAP2K3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100398593 (MAP2K3)
   05135 Yersinia infection
    100398593 (MAP2K3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100398593 (MAP2K3)
   05161 Hepatitis B
    100398593 (MAP2K3)
   05169 Epstein-Barr virus infection
    100398593 (MAP2K3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100398593 (MAP2K3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100398593 (MAP2K3)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100398593 (MAP2K3)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: STE group
  STE7 family
   100398593 (MAP2K3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH Choline_kinase RIO1 DUF4344
Other DBs
NCBI-GeneID: 100398593
NCBI-ProteinID: XP_008989192
LinkDB
Position
Un
AA seq 318 aa
MSKPPTPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTI
MAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDK
FYRKVLEKGMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDF
GISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYE
SWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMVHPFFTLHK
TKKTDIAAFVKEILGEDS
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtccaagccgcccacacccaaccccacacccccccggaacctggactcccggaccttc
atcaccattggagacagaaactttgaggtggaggctgatgacttggtgaccatctcagaa
ctggggcgtggagcctatggggtggtggagaaggtgcggcatgcccagagcggcaccatc
atggccgtgaagcggatccgggccaccgtgaactcacaggagcagaagcggctgctcatg
gacctggacatcaacatgcgcacggtcgactgcttctacaccgtcaccttctatggggca
ctattccgagagggagacgtgtggatctgcatggagctcatggacacatccctggacaag
ttctaccggaaggtgctggagaaaggcatgacaattccagaggacatcctcggggagatt
gctgtgtctatcgtgcgggccctggagcatctgcacagcaagctgtcggtgatccacaga
gatgtgaagccctccaatgtccttatcaacaaggagggccatgtgaaaatgtgcgacttt
ggcatcagtggctacttggtggactctgtggccaagacgatggatgccggctgcaagccc
tacatggctcctgagaggatcaacccggagctgaaccagaagggctacaatgtcaagtcc
gacgtctggagcctgggcatcaccatgattgagatggccatcctacgattcccttacgag
tcctgggggaccccgtttcagcagctgaagcaggtggtggaggagccgtccccccagctc
ccagctgaccgtttctcccccgagtttgtggacttcactgcgcagtgcctgaggaagaac
cccgcagagcgaatgagctacctggagctgatggtgcaccccttcttcactttgcacaaa
accaagaagacggacattgctgccttcgtgaaggagatcctgggagaagactcatag

DBGET integrated database retrieval system