KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397416Help
Entry
100397416         CDS       T03264                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00052  Galactose metabolism
cjc00500  Starch and sucrose metabolism
cjc01100  Metabolic pathways
cjc04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100397416 (MGAM)
   00500 Starch and sucrose metabolism
    100397416 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100397416 (MGAM)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100397416 (MGAM)
    3.2.1.20  alpha-glucosidase
     100397416 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100397416
NCBI-ProteinID: XP_002752029
Ensembl: ENSCJAG00000013692
LinkDB All DBs
Position
8
AA seq 1865 aa AA seqDB search
MARKKPKKFTTLELVLSVLLLVLFIISVVLIVLLAKESLKSTAPDPGTTGTPAGSTIGST
HPRTTNTPHPGTTGSIHSETTGTPDRGTSGTTPISAECPVVNELERINCIPDQPPTKATC
DQRGCCWSLQGAGSVPWCYYSKNHGYHMEGDLVNTTAGFTARLKNLPSSPLFGSSVDNVL
LTAEYQTSNRFHFKLTDQTKSRYEVPHEHVQSFSGNAAAALTYQVEISKEPFSIKVTRRS
NNRVLFDSSIGPLLFADQFLQLSSRLPSANVYGLGEHVHQQYRHDMNWKTWPIFNRDTTP
NGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPTPAITYRTTGGILDFYVFL
GNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHA
DIDYMDERRDFTYDPVDFKGFPEFVKGLHNNGQKLVIIVDPAISNNSSSSKPYGPYNRGS
DMKIWVNGSDGVTPLIGEVWPGHTVFPDYTNPNCTVWWAKEFELFHNQVEFDGIWIDMNE
VSNFVDGSVSGCSANNLNYPPFIPRILDGCLFCKTLCMDAVQHWGKQYDVHNLYGYSMAV
ATAEAAKTVFPNQRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIP
MVGADICGFALDVPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGAESLLLNSSRHY
LNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYGDNNTWDVHQQFLWGPGLLITPVLDE
GVEKVMAYVPDAVWYDYETGGQVRWRKQKVKMELPGDKIGLHLRGGYIFPTQQPNTTTLA
SRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYK
DPNNLAFNEIKILGTQEPSSITVKHNGVPSQTSPTVTYDSNLKVAIITDINLVLGEAYTV
EWDIKIRDEEKIDCYPDENGASAENCAARGCIWEASNSSGVPFCYFVNDLYTVSDVQYNS
HGATADISLKSSVYATAFPSTPVNPLRLDVTYHKNDMLQFKIYDPNNNRYEVPVPLNTPR
VPASSPEGQVYDVLIKKNPFGIEIRRKSTGTIIWDSQLLGFTFNDMFIRISTRLPSKYLY
GFGETEHRSYRRDLNWHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNSNA
MDVTFQPLPALTYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWALGFQLCRYG
YQNDSEIASLYDEMVAAQIPYDVQYSDIDYMERQLDFTLSPKFAGFPALINRMKADGMRV
ILILDPAISGNETQPYPAFTRGMEDDVFIKYPNDGDIVWGKVWPDFPDVVVNGSLDWDSQ
VELYRAYVAFPDFFRNSTAKWWKREIEELYNNPQNPERSLKFDGMWIDMNEPSSFVNGAV
PSGCRDASLNHPPYMPYLESRDRGLSSKSLCMGSQQILPDGSPVQHYNVHSLYGWSQTRP
TYEAVQEVTGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYT
GADICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDAAFVNISRNVLQTR
YTLLPYLYTLMHKAHTEGVTVVRPLLHEFVSDQVTWDIESQFLLGPAFLVSPVLELNARN
VTAYFPRSRWYDYYTGVDINARGEWKTLPAPLAHINLHVRGGYILPWQEPALNTHFSRQK
FMGFKIALDDEGTAEGWLFWDDGQSIDTYGKGLYYLAKFSASQNTIQSHIIFNNYITGTN
PLKLGYIEIWGVGSVPVTSVSMSVSGMVITPSFNSDRTTQVLNIDVSNRNISLHNFTSLT
WRSTP
NT seq 5598 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaaaaagccgaaaaaatttactactttggagcttgtgctcagtgttcttctg
cttgtgttgtttatcatcagtgtggttctaatcgtgcttttagccaaagagtcactgaaa
tcaacagccccagatcctgggacaactggtactccagctgggagtacaattggttccaca
catcctaggacaactaataccccacatcctggaaccactggttccatacattctgaaaca
actggcaccccagatcgtggaacatctggtaccactcctatttctgctgaatgtccagtg
gtaaatgaattggaacgaattaattgcatccctgaccagccaccaacaaaggccacgtgt
gaccaacgtggctgctgctggagtctccaaggagcaggaagtgttccctggtgctattat
tccaagaatcatggctaccacatggagggtgaccttgtaaacacaactgcaggattcaca
gcccggttgaaaaatctgccttcttcacccctgtttggaagcagtgttgacaatgttctt
ctcacagcagaatatcagacatcgaaccgtttccactttaagttgaccgaccaaactaaa
agcaggtatgaagttccccatgaacacgtgcagtccttcagtggaaatgctgctgctgct
ttgacctaccaagttgaaatctccaaagagccatttagcatcaaagtgaccagaagaagc
aacaatcgtgttttgtttgactcgagcattgggcccctcctgtttgccgaccagttcttg
cagctctcctcccgactgcctagtgctaacgtgtatggcctgggagagcatgtgcaccag
cagtaccggcatgatatgaattggaagacctggcccatatttaacagggacacaactccc
aatggtaatggaactaatttgtatggtgcgcagacattcttcctgtgccttgaagatgct
agtggattgtcctttggggtgtttctgatgaacagcaatgccatggaggttgtccttcag
cccacgccagccatcacttaccgcaccactgggggcattctcgacttctatgtgttcctg
ggaaacactccagagcaagttgttcaagaatatctagagctcattgggcggccagccctt
ccctcctactgggcgcttggatttcacctcagtcgttatgaatatggaaccttagacaac
atgagagaagtggtggagagaaatcgtgcagcacaactcccttatgatgttcagcatgct
gatattgattatatggatgagagaagggacttcacttatgatccagtggattttaaaggt
ttccctgagtttgtcaaggggttgcacaataatggacagaagcttgtcatcattgtggat
ccagccatctctaacaactcttcctcaagtaaaccttatggcccatataacaggggttca
gatatgaagatatgggtgaatggttcagatggagtcactccactcattggggaggtctgg
cctggacacactgtgtttcctgattataccaatcccaactgtactgtttggtgggcaaag
gaatttgagctttttcacaatcaagtagagtttgatggaatctggattgatatgaatgaa
gtctccaactttgttgatggctcggtctcaggatgttctgcaaacaacctaaattatccc
ccattcattccaagaatcctagatgggtgcctattctgcaagactctctgtatggatgca
gtgcagcactggggcaagcagtatgatgttcacaatctgtatggctactccatggcagtc
gccacagcagaagctgccaagactgtgttccctaatcagagaagcttcattctgacccgt
tctacctttgcggggtctggcaagtttgcagcacattggttaggagacaacacagccacg
tgggacgaccttcgatggtccatccctggcgtgcttgagttcaacctttttggtatccca
atggtgggtgctgacatatgtggctttgccttggacgtccctgaggagctctgtaggcgg
tggatgcagctgggtgcgttttatccattttctaggaatcacaatggccaaggctacaag
gaccaggatcctgcttcctttggagctgagtccctgctgttgaattcctccaggcactac
cttaacatccgctatactctattgccctacctgtacaccctcttcttccgtgcccacagc
cgaggggacacggtggccaggccccttttgcatgagttctatggggacaacaacacttgg
gatgtgcaccaacagttcttatgggggcctggcctcctcatcactccagttctggatgaa
ggtgtggagaaagtgatggcatatgtgcctgatgctgtctggtatgactatgagactggg
ggccaagtgagatggaggaagcaaaaagtcaagatggaacttcctggagacaaaattgga
cttcaccttcgaggaggctacatcttccccacacagcagccaaatacaaccactctggcc
agtcgaaagaaccctcttggtcttatcattgccctagatgagaacaaagaagcaaaagga
gaacttttctgggatgatggggaaacgaaggatactgtggccaataaagtgtatctttta
tgtgagttttctgtcactcaaaaccgcttggaggtgaatatttcacaatcaacctacaag
gaccccaataatttagcatttaatgagattaaaattcttgggacacaggaacctagcagt
attacagtgaaacacaatggtgtcccaagtcagacttctcctacagtcacttatgattcc
aacctgaaggttgccattatcacagacatcaatcttgtcctgggagaagcatacacagtg
gagtgggacataaaaataagggacgaagaaaaaatagactgttaccctgatgagaatggt
gcttctgcagaaaactgcgctgcccgtggctgcatctgggaggcatccaattcttctgga
gtcccgttttgctattttgtcaacgatctatacactgtcagtgatgttcaatataattca
catggggccacggctgacatctccttaaagtcttctgtttatgccactgccttcccttcc
acacccgtgaacccccttcgcctggatgtaacttaccataagaatgacatgctgcagttc
aagatttatgatcccaacaacaatcggtatgaagtcccagtccctctgaacacacccagg
gttccagccagcagccctgagggtcaagtctatgatgtcctcattaagaagaatccattt
ggaattgaaattcgccggaagagtacaggcactataatttgggactctcagctccttggt
ttcaccttcaatgacatgtttatccgcatctccacccgccttccctccaagtacctctat
ggctttggggaaactgagcacaggtcctacaggagagacttgaattggcacacatggggg
atgttctcccgagaccagcctccagggtacaagaagaattcctatggtgtccacccctac
tacatggggctggaggaggacggcagtgcccatggagtgctcctgctgaacagcaatgcc
atggatgtgacgttccagcccctgcctgccttgacatatcgtaccacggggggagttctg
gacttttatgtgttcttggggcccactccagagcttgtcacccagcagtacactgagttg
attggccggcctgtgatggttccttactgggccttgggcttccagctgtgtcgctatgga
taccagaatgactctgagattgccagcttgtatgatgagatggtggccgcccagatccct
tatgatgtgcagtactcagatattgactacatggagcggcagctggacttcaccctcagc
cccaagtttgctgggtttccagctctgatcaatcgcatgaaggctgacgggatgcgggtc
atcctcattctggatccagccatttctggcaatgagacacagccctatcctgccttcact
cggggcatggaggatgacgtcttcatcaaatacccaaatgatggagacattgtctgggga
aaggtctggcctgattttcctgatgttgttgtgaatgggtctctagactgggacagtcaa
gtggagctatatcgagcttatgtggctttcccagactttttccgtaattcaactgccaag
tggtggaagagggaaatagaagaactatacaacaatccacagaatccagagaggagcttg
aagtttgatggcatgtggattgatatgaatgaaccatcgagcttcgtgaatggggcagtt
ccttcaggctgcagggatgcctctctgaaccaccctccctacatgccatatttggagtcc
agggacaggggcctgagcagcaagagcctgtgcatggggagtcagcagatcctcccagac
ggctcccccgtgcagcactacaacgtgcacagcctgtacgggtggtcccagaccagaccc
acatacgaagccgtgcaggaggtgactggacagcgaggggttgtcatcacccgctccaca
tttccctcttctggccgctgggcaggacattggctgggagacaacacggccgcgtgggat
cagctgaagaaatctatcattggcatgatggagttcagcctctttggcatatcctacaca
ggagcagatatctgtggtttctttcaagacgctgaatatgagatgtgtgttcgctggatg
cagctgggggccttttaccccttctcaagaaaccacaacaccattgggaccaggagacaa
gaccctgtatcctgggatgctgcttttgtgaatatttccagaaatgtcctgcagaccaga
tacaccctgttgccgtatctctataccttgatgcataaggcccacacggagggtgtcact
gttgttcggcctctgctccatgagtttgtgtcagatcaggtgacatgggacatagagagt
cagttcctgctgggcccagccttcctggtcagccctgtcctggagctcaatgccagaaat
gtcaccgcatatttccctagatcccgctggtatgattactacacgggtgtggatattaat
gcaagaggtgagtggaagaccttgcccgcccctcttgcccacattaatcttcatgtccgt
gggggctacatcctgccctggcaagagcctgcactgaacacccacttcagccgccagaaa
ttcatgggcttcaaaattgccttggatgatgagggaactgctgagggttggctcttctgg
gatgatgggcagagcattgacacctatgggaaaggactctattacttggccaagttttct
gccagccagaacacaatacagagtcatataattttcaacaattacatcactggtacaaac
cctttgaaactgggctacattgaaatctggggagtgggcagtgtccccgttaccagtgtc
agcatgtctgtgagcggcatggtcataacaccctccttcaacagtgaccgcacgacacag
gtgttaaacatcgatgtgagcaacagaaacatcagcctacataatttcacttcattgaca
tggagaagcactccttga

DBGET integrated database retrieval system