KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397713
Entry
100397713         CDS       T03264                                 

Gene name
SLC2A2
Definition
(RefSeq) solute carrier family 2 member 2
  KO
K07593  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04911  Insulin secretion
cjc04917  Prolactin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04930  Type II diabetes mellitus
cjc04931  Insulin resistance
cjc04950  Maturity onset diabetes of the young
cjc04973  Carbohydrate digestion and absorption
cjc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100397713 (SLC2A2)
   04922 Glucagon signaling pathway
    100397713 (SLC2A2)
   04917 Prolactin signaling pathway
    100397713 (SLC2A2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100397713 (SLC2A2)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    100397713 (SLC2A2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100397713 (SLC2A2)
   04950 Maturity onset diabetes of the young
    100397713 (SLC2A2)
   04931 Insulin resistance
    100397713 (SLC2A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjc02000]
    100397713 (SLC2A2)
Transporters [BR:cjc02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   100397713 (SLC2A2)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    100397713 (SLC2A2)
SSDB
Motif
Pfam: Sugar_tr MFS_1 OATP HlyE Apis_Csd
Other DBs
NCBI-GeneID: 100397713
NCBI-ProteinID: XP_002759431
Ensembl: ENSCJAG00000002414
UniProt: F7AN96
LinkDB
Position
17
AA seq 524 aa
MTEDKVTGTLVFTVVTAALGSFQFGYDIGVINAPQQTIISHYRHVLGVPLDDRKAINNYV
INSTDELPTIPYSMSPEPTPWTEEETVAATNLITMFWSLSVSSFAVGGMIASFFGGWLGD
TLGRIKAMLVANILSLVGALLMGFSKLGPSHILIIAGRSISGLYCGLISGLVPMYIGEIA
PTSLRGALGTLHQLAIVTGILVSQIVGLEFILGNHDLWHILLGLSAVRAILQSVLLFFCP
ESPRYLYIKLDEEVKAKKSLKRLRGYDDVTKDINEMRKEREEASREQKVSIIQLFTNSNY
RQPILVALMLHMAQQFSGINGIFYYSTSIFQTAGISKPVYATIGVGAINMIFTAVSVFLV
EKAGRRSLFLIGMSGMFVCAIFMSVGLVLLNKLSWMSYVSMIAIFLFVSFFEIGPGPIPW
FMVAEFFSQGPRSAALAIAAFSNWTCNFIVALCFQYIADFCGPYVFFLFAGVLLAFTLFT
FFKVPETKGKSFEEIAAEFQKKSGSAHRPKAAVEMKFLGATETV
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgacagaagataaggtcactgggaccttggttttcactgtcgtcactgctgcactgggt
tccttccagtttggatatgacattggtgtgatcaacgcacctcaacagacaataatatct
cactatagacatgttttgggtgttccactggatgaccgaaaagctatcaacaactatgtt
atcaacagtacagatgaacttcccacaatcccatactcaatgagcccagaaccaacccct
tggactgaggaagagactgtggcagctactaacctaatcaccatgttctggtccctgtct
gtatccagctttgcagttggtggaatgattgcatcattctttggtgggtggcttggggac
acacttggaagaatcaaagccatgttagtagcaaacattctttcattagtcggagctctc
ttgatggggttttcaaaattggggccatctcatatacttataattgctggaagaagcata
tcaggactatattgtgggctaatctcaggcctggttcctatgtatattggtgaaattgct
ccaaccagtctgaggggcgcgcttggcactttgcatcagctggccattgtcacaggcatt
cttgttagtcagattgttggtcttgaatttatcctgggcaatcacgatctgtggcatatc
ctgctcggcctgtctgctgtgcgagccatccttcagtctgtgctactctttttctgtcca
gaaagccccagatacctttacatcaagttagatgaggaagtcaaagcaaagaaaagcttg
aaaagactcagaggatatgatgatgtcaccaaagacattaatgaaatgagaaaagaaaga
gaagaggcatcaagagagcagaaagtctctataattcagcttttcaccaattctaactac
cgacagcctattctagtggcactgatgctgcacatggctcagcaattttccggaatcaat
gggattttttactactcaaccagcatttttcagacggctggtatcagcaaacctgtgtat
gcaaccattggagttggtgctataaacatgattttcactgctgtctctgtattcctcgtg
gagaaggcagggcgacgttctctctttctaattggaatgagcgggatgtttgtttgtgcc
atcttcatgtccgtgggacttgtactgctgaataagttatcttggatgagttacgtgagc
atgatagccatcttcctctttgtcagcttctttgaaattgggccaggcccgatcccctgg
ttcatggtggctgagtttttcagtcaaggaccccgttctgctgcattagcaatagctgcc
ttcagcaactggacctgcaatttcattgtagctctgtgtttccagtacattgcggacttc
tgtggaccttatgtgtttttcctctttgctggagtgctcctggcctttaccctgtttaca
ttttttaaagttccagaaaccaaaggaaagtcttttgaggaaattgctgcagaattccaa
aagaagagtggctcagcccacaggccaaaagctgccgtagaaatgaaattcctaggagct
acagagactgtgtaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404544
Entry
100404544         CDS       T03264                                 

Gene name
SLC2A1
Definition
(RefSeq) solute carrier family 2 member 1
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04066  HIF-1 signaling pathway
cjc04911  Insulin secretion
cjc04919  Thyroid hormone signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04922  Glucagon signaling pathway
cjc04931  Insulin resistance
cjc04976  Bile secretion
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05211  Renal cell carcinoma
cjc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100404544 (SLC2A1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100404544 (SLC2A1)
   04922 Glucagon signaling pathway
    100404544 (SLC2A1)
   04920 Adipocytokine signaling pathway
    100404544 (SLC2A1)
   04919 Thyroid hormone signaling pathway
    100404544 (SLC2A1)
  09154 Digestive system
   04976 Bile secretion
    100404544 (SLC2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100404544 (SLC2A1)
   05230 Central carbon metabolism in cancer
    100404544 (SLC2A1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100404544 (SLC2A1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100404544 (SLC2A1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100404544 (SLC2A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjc02000]
    100404544 (SLC2A1)
Transporters [BR:cjc02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   100404544 (SLC2A1)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    100404544 (SLC2A1)
SSDB
Motif
Pfam: Sugar_tr MFS_1 DUF2127 DUF523 Pox_EPC_I2-L1
Other DBs
NCBI-GeneID: 100404544
NCBI-ProteinID: XP_002750748
Ensembl: ENSCJAG00000003279
UniProt: F6PYB0
LinkDB
Position
7
AA seq 492 aa
MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWIHRYGESILPTT
LTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFE
MLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIM
GNEDLWPLLLSIIFVPALLQCTVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHD
LQEMKEESRQMMREKKVTILELFRSAAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEK
AGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAILMTIALALLEQ
LPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGNSQSDKTPE
ELFHPLGADSQV
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggagcccagcagcaagaagctgacgggtcgcctcatgctggccgtgggaggggcagtg
ctcggctccctgcagtttggctacaacactggagtcatcaatgccccccagaaggtgatc
gaggagttctacaaccagacatggatccaccgctatggggagagcatcctgcccaccacg
ctcaccacgctctggtccctctcagtggccatcttctccgttgggggcatgattggctcc
ttctctgtgggccttttcgttaaccgctttggccggcggaattcaatgctgatgatgaac
ctgctggccttcgtgtctgccgtgctcatgggcttctcgaaactgggcaagtcctttgag
atgctgatcctgggccgcttcatcatcggcgtgtactgcggactgaccacaggcttcgtg
cccatgtatgtgggtgaagtgtcacccacagcccttcgtggggccctgggcaccctgcac
cagctgggcatcgttgttggcatcctcatcgcccaggtgtttggcctggactccatcatg
ggcaatgaggacctgtggcccctgctgctgagcatcatcttcgtcccggccctgctgcag
tgcactgtgctgcccttctgccccgagagcccccgcttcctgctcatcaaccgcaacgag
gagaaccgggccaagagtgtgctgaagaagctgcgcgggacggctgacgtgacccatgac
ctgcaggagatgaaggaggagagtcgacagatgatgcgggagaagaaggtcaccatcctg
gagctgttccgctcggccgcctaccgtcagcccatcctcatcgccgtggtgctgcagctg
tcccagcagctgtcaggcatcaacgctgtcttctattactccacaagcatctttgagaag
gcaggagtgcagcagcctgtgtacgccaccatcggctccggcatcgtcaacacggccttc
accgtcgtgtcgctatttgtggtggagcgagcaggccggcggaccctgcacctcataggc
ctggctggcatggcgggttgtgccatactcatgaccatcgcgctggcactgctggagcag
ctgccctggatgtcctatctgagcattgtggccatttttggcttcgtggccttctttgaa
gtgggtcccggccccatcccatggttcatcgtggctgaactcttcagccagggtcctcgt
ccagctgccattgctgttgcaggcttctccaactggacctcaaatttcattgtgggcatg
tgcttccagtatgtggagcaactgtgtggtccctacgtcttcatcatcttcactgtgctc
ctggttctgttcttcatcttcacctacttcaaagttcctgagactaaaggccggaccttc
gatgagattgcttccggcttccggcaggggggaaacagccaaagtgacaagacacccgaa
gagctgttccatcctctgggggctgattcccaagtgtga

DBGET integrated database retrieval system