KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397786Help
Entry
100397786         CDS       T03264                                 

Definition
(RefSeq) WAS protein family homolog 2-like
  KO
K18461  WAS protein family homolog 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100397786
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100397786
Membrane trafficking [BR:cjc04131]
 Endosome - Lysosome transport
  Others
   WASH complex
    100397786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WASH_WAHD
Motif
Other DBs
NCBI-GeneID: 100397786
NCBI-ProteinID: XP_009001622
Ensembl: ENSCJAG00000006744
LinkDB All DBs
Position
9
AA seq 469 aa AA seqDB search
MTPVKTQHSLSGQTYAVPLIQPDLRREEAVQQMADALQYLQKVSGDIFSRISQRVEQSRS
QVQAIGEKVSLAQAKIEKIKGSKKAIKVFSSAKYPAPERLQEYGSIFTGAQDPGLQRRPR
HRIQSKHRTLDERALQEKLKYFPVCVSAKPEPEDEAEEGLGGLPSNISSVSSLLLFNTTE
NLYKKYVFLDPLAGAVTKTHVMLGVETEEKLFDAPLSISKREQLEQQVPENYFYVPDLGQ
VPEIDVPSYLPDLPGIANDLMYSADLGPGIAPSAPGTIPELPTFHTEVAEPLKPDLEDGV
LTAPPPPPPPPPPPPAPEVLASAPPLPPSAVAPVGPGARQDDGSGVSPSAPVQGVPREAV
DPSGGRATLLESIRQAGGIGKAKLRSVKERKLEKKKQKEQEQVRATSQGGDLMSDLFNKL
VMRRKGISGKGPGAGEGPGGAFAHLSDSIPPLPPPQQPQAEEDEDDWES
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgactcctgtgaagacccagcactccctgtcaggtcagacatatgctgtgcccctcatc
cagccagacctgcggcgagaggaggccgttcagcagatggcagatgccctgcagtacctg
cagaaggtctctggagacatcttcagcaggatctcccagcgggtagagcagagccggagc
caggtgcaggccatcggggagaaggtctccttggcccaggctaagattgagaagatcaag
ggcagcaagaaggccatcaaggtgttctccagtgccaagtaccctgctccagagcgccta
caggaatatggctccatcttcacaggcgcccaggaccctggcctgcagagacgaccccgc
cacaggatccagagcaagcaccgcactctggatgagcgggccctgcaggagaagctgaag
tactttcctgtgtgcgtgagtgccaagccggagcctgaggatgaggcagaggagggactt
gggggtcttcccagcaacatcagctctgtcagctccttgctgctcttcaacaccaccgag
aacttgtacaagaagtatgtcttcctggaccccctggctggtgctgtaacaaagacccat
gtgatgctgggggtggagacggaggagaagctgtttgatgcccccttgtccatcagcaag
agagagcagctggagcagcaggttccagagaactacttctatgtgccagacctgggccaa
gtacctgagattgatgtgccatcctacctgcccgacctgcccggcattgccaatgacctc
atgtacagtgccgacctgggccccggcattgccccctctgcccctggcaccattccagaa
ctgcccaccttccacactgaggtagccgagcctctcaagccagacctagaagatggggta
ctcacagcacccccaccgcccccaccacccccaccacctcccccagctcctgaggtgctg
gccagtgcaccccctctcccaccctcagccgtggcccccgtaggcccaggcgccaggcag
gacgacggcagcggcgtgtctccttcagctccagtccagggagttcccagggaagcggtt
gacccctctggtggccgggccactctgctagagtccatccgccaagctgggggcatcggc
aaggccaagctgcgcagcgtgaaggagcgaaagctggagaagaagaagcagaaggagcag
gagcaagtgagagccacgagccaaggtggggacctaatgtcggatctcttcaacaagctg
gtcatgaggcgcaagggcatctctgggaaaggacccggggctggtgagggacctggagga
gccttcgcccacctgtcagactccatccctcctctgccgccaccacagcagccgcaggca
gaagaggatgaggacgactgggaatcctag

DBGET integrated database retrieval system