KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397827Help
Entry
100397827         CDS       T03264                                 

Gene name
TSC22D4
Definition
(RefSeq) TSC22 domain family member 4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
SSDB OrthologParalogGFIT
Motif
Pfam: TSC22 YabA K-box ZapB DivIC
Motif
Other DBs
NCBI-GeneID: 100397827
NCBI-ProteinID: XP_002806628
LinkDB All DBs
Position
2
AA seq 395 aa AA seqDB search
MSGGKKKSSFQITSVTTDYEGPGSPAASDPLAHCPPPGPHPACQNGEHSPDPGGKGTPRN
GSPPPGAPSSRFRVVKLSHGLGEPYRRGRWTCVDVYERDLEPHSFGRLLEGIRGTSAGAG
GRSLDSRLELASLGLGTPTPQSGLSQGPTSWLRPPPTSPGPQARSFTGGLGQLVVPGKAK
AETPPLSASPPQQRPPEPGTGESGGTSRAATPLPSLRVEAEAGGSGSRTPPLSRRKAVDM
RLRMELGAPEEMGQVFPLDSRPSSPAFYFASDASLAHKSPDPFGAVAAQKFSLAHSMLAI
SGHLDSDDDSGSGSLVGIDNKIEQAMDLVKSHLMFAVREEVEVLKEQIRDLAERNAALEQ
ENGLLRALASPEQLAQLPSSGVPRLGHPAPNGPSV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggggcaagaagaagagtagtttccaaatcaccagcgtgaccacggactacgag
ggcccggggagcccagcggcttcggaccccctggcccactgccccccaccgggcccccac
cccgcctgccaaaatggggagcacagccctgatccggggggcaagggcaccccccgtaat
ggctctcccccacctggggccccctcctcccgtttccgggtggtgaagctgtcccacggc
ctgggagagccttatcgccgaggtcgctggacttgtgtggatgtttatgagcgagacctg
gagccccacagctttggccgcctcctggagggaattagagggacatcagcgggcgctggg
ggcagatctttggattccaggttggagctggccagcctcggcctgggcacccccacccca
cagtcaggcctgtctcagggccccacctcctggctccgtccaccgccgacctctcccgga
cctcaggcccgctccttcactggggggctgggccagctggtggtgcccggaaaagccaag
gcagagacacccccactgtcggcttccccgcctcagcagcgccccccagagcctgggact
ggggagagtgggggcacatctcgggctgccacacccctgccctccctgagggtggaagca
gaggctgggggctccgggtccaggacccctccactgtcccggaggaaggctgtagacatg
cggctgcggatggagttgggtgctccagaggagatggggcaggtgttcccactcgactct
cgccccagctcccctgccttctacttcgcttcggatgccagcctggctcacaaatctcca
gacccctttggagcagtagcagctcagaaattcagcctggcccactccatgttagccatc
agtggtcacctagacagcgatgacgatagtggctccggaagcctggttggcattgacaac
aaaatcgagcaagccatggacttggtgaagtcccacctcatgtttgcggtccgggaggag
gtggaggtgctgaaggagcagatccgggacctggcggagcggaacgccgcgctggagcag
gagaatgggctgctgcgagccctggccagcccggagcagctggctcagctgccctcctcg
ggggtcccgcggcttgggcaccccgcgcccaatgggccctccgtctga

DBGET integrated database retrieval system